Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178Z5G4

Protein Details
Accession A0A178Z5G4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
124-158ERERRERDEEKTRRNRERRNRRKGKKDHQEKQTDGBasic
NLS Segment(s)
PositionSequence
119-150KWEREERERRERDEEKTRRNRERRNRRKGKKD
Subcellular Location(s) nucl 18, cyto_nucl 13.333, mito_nucl 10.333, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPEAIPTSADPRSHRPLKRARGAYTANPNVRAISQQAHELETLFLDPSRPVQLPPPSSAVKKSLPAPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRAMDEEAKKEEENEKWEREERERRERDEEKTRRNRERRNRRKGKKDHQEKQTDGAVKGTKEAVQNGEAHGVKRKAGGPQTPPKEIQDEEQGSDFGVAEVVKEAGITIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.4
4 0.48
5 0.51
6 0.56
7 0.63
8 0.69
9 0.75
10 0.75
11 0.7
12 0.69
13 0.69
14 0.68
15 0.68
16 0.67
17 0.6
18 0.55
19 0.51
20 0.44
21 0.4
22 0.33
23 0.25
24 0.21
25 0.19
26 0.21
27 0.22
28 0.22
29 0.21
30 0.2
31 0.18
32 0.14
33 0.13
34 0.09
35 0.08
36 0.08
37 0.08
38 0.09
39 0.13
40 0.13
41 0.13
42 0.19
43 0.26
44 0.28
45 0.31
46 0.33
47 0.32
48 0.33
49 0.35
50 0.33
51 0.28
52 0.28
53 0.29
54 0.3
55 0.28
56 0.29
57 0.29
58 0.25
59 0.24
60 0.22
61 0.19
62 0.16
63 0.15
64 0.13
65 0.1
66 0.09
67 0.07
68 0.07
69 0.06
70 0.04
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.07
79 0.07
80 0.12
81 0.19
82 0.26
83 0.31
84 0.35
85 0.41
86 0.49
87 0.56
88 0.61
89 0.62
90 0.57
91 0.53
92 0.5
93 0.46
94 0.42
95 0.36
96 0.29
97 0.23
98 0.22
99 0.2
100 0.2
101 0.22
102 0.18
103 0.22
104 0.24
105 0.24
106 0.25
107 0.29
108 0.3
109 0.35
110 0.42
111 0.44
112 0.51
113 0.53
114 0.54
115 0.59
116 0.6
117 0.59
118 0.61
119 0.62
120 0.62
121 0.68
122 0.73
123 0.75
124 0.8
125 0.84
126 0.84
127 0.88
128 0.88
129 0.89
130 0.92
131 0.91
132 0.93
133 0.94
134 0.94
135 0.93
136 0.93
137 0.91
138 0.9
139 0.88
140 0.79
141 0.73
142 0.68
143 0.61
144 0.5
145 0.46
146 0.39
147 0.3
148 0.29
149 0.26
150 0.23
151 0.21
152 0.22
153 0.2
154 0.19
155 0.2
156 0.19
157 0.24
158 0.22
159 0.21
160 0.27
161 0.25
162 0.24
163 0.26
164 0.28
165 0.28
166 0.34
167 0.39
168 0.41
169 0.5
170 0.55
171 0.57
172 0.56
173 0.53
174 0.5
175 0.45
176 0.4
177 0.4
178 0.37
179 0.34
180 0.33
181 0.3
182 0.26
183 0.26
184 0.22
185 0.12
186 0.1
187 0.08
188 0.07
189 0.08
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.07