Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DNF2

Protein Details
Accession J9DNF2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-49FAFFKISKKLAERRRRKFVRNARKSIENNHydrophilic
NLS Segment(s)
PositionSequence
28-44KKLAERRRRKFVRNARK
Subcellular Location(s) E.R. 6, nucl 5.5, mito 4, plas 4, cyto_nucl 3.5, pero 3, extr 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSHVLRNTTIIIVAIVIVAFAFFKISKKLAERRRRKFVRNARKSIENNLAAHRTEMEYFRNLNLDHPDRAKNMNLLFVNLQTLRNQYSTFLSKRPIVLEDNLPQIILYVEKIKYAREITYDCVCEFLKYLSNKYGIDNQKFHSFLHKFKKAYYSLIRSENSIYMEKNAKRFQVAKNITFLFKNMLLILSLSLSDIFVKYDKVLVLITKLNKLICIFENMESEINKYIISNSSDTTFMDENYVFQANLDGFDTRIRDTCFILDLIDGIVFRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.05
5 0.04
6 0.04
7 0.04
8 0.03
9 0.05
10 0.06
11 0.08
12 0.12
13 0.14
14 0.19
15 0.27
16 0.36
17 0.45
18 0.56
19 0.65
20 0.71
21 0.8
22 0.84
23 0.85
24 0.86
25 0.87
26 0.87
27 0.87
28 0.87
29 0.81
30 0.82
31 0.77
32 0.73
33 0.71
34 0.64
35 0.56
36 0.52
37 0.49
38 0.4
39 0.38
40 0.32
41 0.24
42 0.21
43 0.21
44 0.19
45 0.19
46 0.2
47 0.2
48 0.22
49 0.21
50 0.22
51 0.27
52 0.28
53 0.28
54 0.31
55 0.33
56 0.32
57 0.34
58 0.33
59 0.3
60 0.27
61 0.3
62 0.26
63 0.25
64 0.23
65 0.21
66 0.22
67 0.19
68 0.19
69 0.14
70 0.16
71 0.16
72 0.16
73 0.16
74 0.14
75 0.17
76 0.22
77 0.23
78 0.23
79 0.24
80 0.25
81 0.26
82 0.26
83 0.25
84 0.22
85 0.22
86 0.24
87 0.24
88 0.25
89 0.23
90 0.21
91 0.18
92 0.16
93 0.14
94 0.09
95 0.07
96 0.08
97 0.08
98 0.1
99 0.11
100 0.11
101 0.14
102 0.15
103 0.15
104 0.14
105 0.16
106 0.17
107 0.21
108 0.22
109 0.19
110 0.19
111 0.19
112 0.16
113 0.15
114 0.12
115 0.14
116 0.14
117 0.16
118 0.17
119 0.19
120 0.19
121 0.2
122 0.27
123 0.27
124 0.3
125 0.31
126 0.3
127 0.32
128 0.33
129 0.31
130 0.32
131 0.28
132 0.32
133 0.39
134 0.44
135 0.4
136 0.41
137 0.47
138 0.4
139 0.44
140 0.43
141 0.39
142 0.37
143 0.42
144 0.4
145 0.35
146 0.35
147 0.3
148 0.26
149 0.22
150 0.18
151 0.16
152 0.23
153 0.24
154 0.28
155 0.29
156 0.27
157 0.29
158 0.33
159 0.34
160 0.37
161 0.41
162 0.36
163 0.38
164 0.39
165 0.37
166 0.33
167 0.3
168 0.22
169 0.18
170 0.17
171 0.12
172 0.11
173 0.1
174 0.1
175 0.09
176 0.06
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.06
185 0.07
186 0.07
187 0.09
188 0.09
189 0.1
190 0.1
191 0.1
192 0.12
193 0.16
194 0.18
195 0.19
196 0.21
197 0.2
198 0.21
199 0.21
200 0.21
201 0.18
202 0.21
203 0.21
204 0.21
205 0.23
206 0.23
207 0.24
208 0.21
209 0.22
210 0.18
211 0.17
212 0.14
213 0.12
214 0.13
215 0.15
216 0.17
217 0.17
218 0.16
219 0.18
220 0.19
221 0.18
222 0.21
223 0.18
224 0.15
225 0.17
226 0.16
227 0.15
228 0.18
229 0.19
230 0.14
231 0.13
232 0.16
233 0.12
234 0.13
235 0.14
236 0.11
237 0.11
238 0.14
239 0.16
240 0.15
241 0.2
242 0.21
243 0.22
244 0.23
245 0.24
246 0.23
247 0.22
248 0.2
249 0.16
250 0.13
251 0.12
252 0.11
253 0.09