Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DJP8

Protein Details
Accession J9DJP8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEHKRKKIYKDLSKTRINQNIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013272  Vps72/YL1_C  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MEHKRKKIYKDLSKTRINQNIKYKGLKYNLKQLKADHSQYIKNAFTVGKQSFKAVCDITGLPARYKCSKTGIFCHDLSVYEFVREMKSEDFKRYLAQRNIGKNIYAFIRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.8
4 0.75
5 0.72
6 0.72
7 0.72
8 0.68
9 0.68
10 0.61
11 0.59
12 0.61
13 0.61
14 0.54
15 0.56
16 0.58
17 0.56
18 0.56
19 0.5
20 0.51
21 0.49
22 0.49
23 0.43
24 0.4
25 0.38
26 0.38
27 0.41
28 0.32
29 0.26
30 0.24
31 0.19
32 0.16
33 0.2
34 0.2
35 0.18
36 0.18
37 0.2
38 0.19
39 0.2
40 0.21
41 0.15
42 0.14
43 0.13
44 0.12
45 0.13
46 0.15
47 0.15
48 0.14
49 0.16
50 0.19
51 0.21
52 0.22
53 0.22
54 0.25
55 0.29
56 0.31
57 0.37
58 0.4
59 0.4
60 0.38
61 0.39
62 0.33
63 0.29
64 0.28
65 0.24
66 0.18
67 0.14
68 0.15
69 0.13
70 0.14
71 0.14
72 0.14
73 0.15
74 0.22
75 0.25
76 0.3
77 0.32
78 0.31
79 0.36
80 0.42
81 0.47
82 0.46
83 0.51
84 0.53
85 0.59
86 0.65
87 0.61
88 0.55
89 0.45
90 0.42