Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZTG0

Protein Details
Accession A0A178ZTG0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
27-53TTKYALPRKPNTKAKSRPKASREKDDAHydrophilic
NLS Segment(s)
PositionSequence
34-48RKPNTKAKSRPKASR
166-176GGKGKKKKGKK
Subcellular Location(s) mito 16, cyto 6, cyto_nucl 5.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MAYFTDLHTYLHQSSLLLQAYPSARITTKYALPRKPNTKAKSRPKASREKDDAPATAGTTAPSQPQSKREPSAVLTLKTYHAESGICLKYRTDKAAEVGRLLTGLGRLAKGEIIEMPAAPVSAVPGTGIAVDGDKMDVDAGSVATTNQIEDKVVTAPPAVTHGSGGGKGKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.21
4 0.17
5 0.15
6 0.18
7 0.19
8 0.21
9 0.2
10 0.16
11 0.16
12 0.18
13 0.22
14 0.21
15 0.27
16 0.34
17 0.42
18 0.47
19 0.54
20 0.61
21 0.66
22 0.72
23 0.76
24 0.72
25 0.75
26 0.78
27 0.81
28 0.82
29 0.82
30 0.82
31 0.8
32 0.86
33 0.82
34 0.82
35 0.79
36 0.73
37 0.71
38 0.65
39 0.57
40 0.48
41 0.42
42 0.32
43 0.24
44 0.19
45 0.13
46 0.11
47 0.11
48 0.1
49 0.13
50 0.15
51 0.17
52 0.22
53 0.27
54 0.31
55 0.33
56 0.32
57 0.31
58 0.3
59 0.37
60 0.34
61 0.29
62 0.26
63 0.24
64 0.24
65 0.23
66 0.21
67 0.12
68 0.1
69 0.09
70 0.08
71 0.14
72 0.15
73 0.14
74 0.14
75 0.14
76 0.19
77 0.2
78 0.22
79 0.17
80 0.16
81 0.18
82 0.24
83 0.24
84 0.2
85 0.18
86 0.16
87 0.14
88 0.13
89 0.1
90 0.05
91 0.06
92 0.06
93 0.05
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.04
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.06
132 0.06
133 0.07
134 0.07
135 0.08
136 0.08
137 0.09
138 0.1
139 0.1
140 0.11
141 0.11
142 0.11
143 0.11
144 0.1
145 0.13
146 0.13
147 0.12
148 0.12
149 0.14
150 0.14
151 0.17
152 0.22
153 0.27
154 0.34
155 0.41
156 0.5