Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DPY8

Protein Details
Accession J9DPY8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-107IFKMMPNNIKRKKLKRHNHIFLFKYCHydrophilic
NLS Segment(s)
PositionSequence
92-96RKKLK
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MNKKSQLGSGNNNSYGFGKYGPQIAIKGFADKTRMHSNREYEKSRNKSGKQWRQTEYPANIQKNKLIFIQNSSFYIFYQIHIFKMMPNNIKRKKLKRHNHIFLFKYCIHFKKYIKYSVNFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.28
4 0.2
5 0.16
6 0.15
7 0.18
8 0.18
9 0.18
10 0.18
11 0.17
12 0.21
13 0.19
14 0.22
15 0.19
16 0.19
17 0.21
18 0.21
19 0.26
20 0.32
21 0.34
22 0.35
23 0.39
24 0.45
25 0.51
26 0.57
27 0.57
28 0.53
29 0.6
30 0.62
31 0.65
32 0.66
33 0.59
34 0.62
35 0.68
36 0.71
37 0.7
38 0.71
39 0.66
40 0.63
41 0.64
42 0.62
43 0.54
44 0.52
45 0.51
46 0.47
47 0.46
48 0.42
49 0.41
50 0.34
51 0.32
52 0.26
53 0.22
54 0.18
55 0.2
56 0.22
57 0.21
58 0.21
59 0.21
60 0.19
61 0.15
62 0.19
63 0.15
64 0.12
65 0.17
66 0.16
67 0.15
68 0.17
69 0.17
70 0.15
71 0.22
72 0.27
73 0.29
74 0.34
75 0.44
76 0.5
77 0.59
78 0.66
79 0.7
80 0.75
81 0.79
82 0.84
83 0.85
84 0.89
85 0.9
86 0.91
87 0.89
88 0.83
89 0.76
90 0.72
91 0.63
92 0.58
93 0.54
94 0.47
95 0.44
96 0.47
97 0.47
98 0.51
99 0.55
100 0.59
101 0.6
102 0.61