Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZY98

Protein Details
Accession A0A178ZY98   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
91-117DEQFERQQRRCRWHHPRFREPMRPSRQBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042098  TauD-like_sf  
IPR003819  TauD/TfdA-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF02668  TauD  
Amino Acid Sequences MPGLIAQPESDFYNITVKKLHPTFAAQISGVDFSQPLSEETFIYPVQYGVVVFRGTNLTDEAHLDFTRRFRELDDVKPYISAGRKNRLRYDEQFERQQRRCRWHHPRFREPMRPSRQGPWKTLPRWSNSFQLITFFNNFRLTPTQGNDLFQVNSSFNPRRAGYSLLLMHELPPPGDVKETLARNNYVAAHSTHHSRKLAAPEFFKDLDPLDYPMGRPYLVQRHESSGRMNLDIASHVHHLEREGREGLLPADEAESARALFDRLYADATQLQYTVEIEWQHPADLVVWDNTCTMHRAVGGPFLRKYRRDSSAQAWSLNEHTDVRVGLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.26
5 0.34
6 0.35
7 0.37
8 0.3
9 0.35
10 0.39
11 0.39
12 0.4
13 0.31
14 0.3
15 0.28
16 0.27
17 0.22
18 0.17
19 0.12
20 0.1
21 0.11
22 0.11
23 0.1
24 0.11
25 0.12
26 0.13
27 0.14
28 0.16
29 0.15
30 0.15
31 0.14
32 0.12
33 0.11
34 0.1
35 0.09
36 0.08
37 0.1
38 0.09
39 0.09
40 0.1
41 0.11
42 0.11
43 0.12
44 0.13
45 0.11
46 0.12
47 0.14
48 0.14
49 0.15
50 0.15
51 0.15
52 0.16
53 0.19
54 0.22
55 0.22
56 0.21
57 0.2
58 0.29
59 0.32
60 0.37
61 0.42
62 0.39
63 0.38
64 0.38
65 0.36
66 0.32
67 0.31
68 0.31
69 0.29
70 0.38
71 0.44
72 0.49
73 0.56
74 0.57
75 0.6
76 0.58
77 0.61
78 0.6
79 0.6
80 0.64
81 0.65
82 0.68
83 0.68
84 0.72
85 0.69
86 0.68
87 0.7
88 0.72
89 0.75
90 0.77
91 0.81
92 0.81
93 0.85
94 0.86
95 0.87
96 0.86
97 0.81
98 0.8
99 0.78
100 0.75
101 0.68
102 0.66
103 0.68
104 0.62
105 0.61
106 0.59
107 0.6
108 0.56
109 0.61
110 0.57
111 0.52
112 0.54
113 0.51
114 0.48
115 0.41
116 0.4
117 0.32
118 0.3
119 0.26
120 0.23
121 0.22
122 0.17
123 0.17
124 0.17
125 0.17
126 0.17
127 0.19
128 0.19
129 0.19
130 0.2
131 0.24
132 0.23
133 0.24
134 0.23
135 0.21
136 0.18
137 0.16
138 0.16
139 0.11
140 0.11
141 0.16
142 0.16
143 0.17
144 0.19
145 0.19
146 0.2
147 0.21
148 0.23
149 0.18
150 0.2
151 0.2
152 0.18
153 0.18
154 0.16
155 0.15
156 0.14
157 0.14
158 0.09
159 0.09
160 0.09
161 0.08
162 0.09
163 0.08
164 0.09
165 0.14
166 0.15
167 0.17
168 0.19
169 0.19
170 0.19
171 0.2
172 0.18
173 0.14
174 0.14
175 0.12
176 0.12
177 0.13
178 0.19
179 0.2
180 0.23
181 0.23
182 0.23
183 0.25
184 0.32
185 0.37
186 0.35
187 0.35
188 0.33
189 0.36
190 0.36
191 0.33
192 0.25
193 0.19
194 0.18
195 0.16
196 0.16
197 0.13
198 0.13
199 0.13
200 0.14
201 0.14
202 0.12
203 0.11
204 0.14
205 0.22
206 0.24
207 0.27
208 0.27
209 0.32
210 0.35
211 0.36
212 0.34
213 0.31
214 0.3
215 0.27
216 0.26
217 0.2
218 0.18
219 0.18
220 0.16
221 0.12
222 0.12
223 0.12
224 0.12
225 0.12
226 0.13
227 0.18
228 0.19
229 0.2
230 0.2
231 0.2
232 0.2
233 0.2
234 0.19
235 0.13
236 0.12
237 0.08
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.07
244 0.07
245 0.07
246 0.07
247 0.06
248 0.08
249 0.09
250 0.09
251 0.12
252 0.12
253 0.14
254 0.16
255 0.18
256 0.16
257 0.15
258 0.14
259 0.12
260 0.12
261 0.11
262 0.11
263 0.11
264 0.11
265 0.15
266 0.15
267 0.15
268 0.15
269 0.15
270 0.13
271 0.13
272 0.14
273 0.13
274 0.13
275 0.14
276 0.14
277 0.14
278 0.14
279 0.15
280 0.14
281 0.13
282 0.13
283 0.15
284 0.16
285 0.24
286 0.27
287 0.3
288 0.33
289 0.39
290 0.45
291 0.45
292 0.52
293 0.51
294 0.53
295 0.54
296 0.57
297 0.57
298 0.61
299 0.61
300 0.56
301 0.49
302 0.46
303 0.42
304 0.38
305 0.32
306 0.23
307 0.2
308 0.2