Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178ZTV5

Protein Details
Accession A0A178ZTV5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
435-476DEQAEEKRGRRHWRRHPNMHHEGDRRRWRDKITERERKRYEGBasic
NLS Segment(s)
PositionSequence
374-387SKKVPPPIPRRRSK
441-473KRGRRHWRRHPNMHHEGDRRRWRDKITERERKR
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
PROSITE View protein in PROSITE  
PS50031  EH  
Amino Acid Sequences MSEKKARRPPVAPKPSFIQQHNAATAKPSPLPSPALQGATLAFGAPAVKSPSIPVSASHNPSASAGALLAATTASIRKQQQRQNEAPSQESAVNPRGRALTTEKLPVAVTDHSSLSPPKLGLRPHPPRSTSAVAAVAASAKTSPVRRPELKRDLASAYLARRDPSQVRGRGMSTSSSSEAVSSIQQSAAALAGAKASMTTIAPVQVQTGTGDKHRSELGYLLNLPLYSAQPSSAPSPSLSGATAAATASRNAASLEARKRVLSTSEESSPSAPVLRNLTASPQSTTGSLWPRLRVTPPQTDSESDTGRSKIEHTPQPLAAPVPLRANRAAVVAQEQAPVQDTRTGMTASSLADAMVAGSIAATHTGSRGASPASKKVPPPIPRRRSKSVGAFSGARQLMHLPGMRSETVSQTPKLKPLPMRPMRQTLRNNSPDRDEQAEEKRGRRHWRRHPNMHHEGDRRRWRDKITERERKRYEGVWAANRGLLLDYDLDNPDSELRKDGTPASDLVVNVVVRDIWERSRLPKDVLEEIWDLVAQPGAKTLNREEFVVGLWLIDQRLKGRKLPVKVSPSVWSSVRHPQGVKISSKALHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.68
4 0.6
5 0.57
6 0.53
7 0.57
8 0.58
9 0.53
10 0.45
11 0.42
12 0.42
13 0.38
14 0.34
15 0.3
16 0.26
17 0.28
18 0.33
19 0.31
20 0.34
21 0.34
22 0.32
23 0.3
24 0.28
25 0.25
26 0.21
27 0.2
28 0.13
29 0.09
30 0.07
31 0.08
32 0.07
33 0.1
34 0.12
35 0.13
36 0.13
37 0.15
38 0.18
39 0.21
40 0.21
41 0.19
42 0.24
43 0.31
44 0.35
45 0.36
46 0.33
47 0.31
48 0.31
49 0.31
50 0.23
51 0.16
52 0.11
53 0.09
54 0.08
55 0.07
56 0.07
57 0.05
58 0.04
59 0.05
60 0.06
61 0.07
62 0.13
63 0.19
64 0.28
65 0.37
66 0.44
67 0.54
68 0.62
69 0.68
70 0.71
71 0.73
72 0.67
73 0.61
74 0.56
75 0.49
76 0.42
77 0.36
78 0.32
79 0.32
80 0.32
81 0.29
82 0.3
83 0.29
84 0.27
85 0.29
86 0.3
87 0.3
88 0.3
89 0.35
90 0.33
91 0.32
92 0.32
93 0.28
94 0.25
95 0.2
96 0.19
97 0.16
98 0.17
99 0.16
100 0.18
101 0.19
102 0.18
103 0.18
104 0.16
105 0.19
106 0.22
107 0.25
108 0.31
109 0.41
110 0.49
111 0.55
112 0.61
113 0.59
114 0.58
115 0.62
116 0.58
117 0.49
118 0.42
119 0.35
120 0.28
121 0.26
122 0.22
123 0.16
124 0.12
125 0.1
126 0.07
127 0.07
128 0.09
129 0.12
130 0.17
131 0.23
132 0.31
133 0.39
134 0.47
135 0.57
136 0.63
137 0.67
138 0.64
139 0.61
140 0.55
141 0.49
142 0.43
143 0.36
144 0.29
145 0.27
146 0.26
147 0.23
148 0.22
149 0.25
150 0.25
151 0.3
152 0.37
153 0.36
154 0.38
155 0.4
156 0.4
157 0.37
158 0.36
159 0.3
160 0.23
161 0.22
162 0.2
163 0.19
164 0.17
165 0.15
166 0.14
167 0.13
168 0.12
169 0.1
170 0.09
171 0.08
172 0.09
173 0.08
174 0.08
175 0.07
176 0.06
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.03
183 0.03
184 0.04
185 0.04
186 0.04
187 0.05
188 0.06
189 0.07
190 0.07
191 0.08
192 0.07
193 0.08
194 0.08
195 0.09
196 0.09
197 0.11
198 0.15
199 0.14
200 0.15
201 0.16
202 0.15
203 0.14
204 0.16
205 0.15
206 0.14
207 0.14
208 0.13
209 0.13
210 0.12
211 0.11
212 0.1
213 0.09
214 0.08
215 0.07
216 0.07
217 0.07
218 0.09
219 0.12
220 0.12
221 0.12
222 0.11
223 0.12
224 0.12
225 0.13
226 0.11
227 0.09
228 0.09
229 0.08
230 0.08
231 0.06
232 0.07
233 0.06
234 0.06
235 0.07
236 0.06
237 0.06
238 0.06
239 0.07
240 0.08
241 0.13
242 0.18
243 0.2
244 0.21
245 0.21
246 0.21
247 0.21
248 0.22
249 0.2
250 0.19
251 0.19
252 0.21
253 0.22
254 0.22
255 0.22
256 0.19
257 0.16
258 0.15
259 0.11
260 0.1
261 0.12
262 0.12
263 0.13
264 0.13
265 0.15
266 0.16
267 0.17
268 0.16
269 0.14
270 0.14
271 0.14
272 0.14
273 0.15
274 0.16
275 0.2
276 0.2
277 0.2
278 0.21
279 0.22
280 0.24
281 0.26
282 0.27
283 0.3
284 0.32
285 0.33
286 0.33
287 0.33
288 0.34
289 0.31
290 0.27
291 0.2
292 0.19
293 0.17
294 0.15
295 0.15
296 0.14
297 0.16
298 0.22
299 0.25
300 0.27
301 0.29
302 0.29
303 0.29
304 0.27
305 0.23
306 0.18
307 0.15
308 0.13
309 0.16
310 0.17
311 0.19
312 0.18
313 0.19
314 0.18
315 0.18
316 0.17
317 0.11
318 0.12
319 0.11
320 0.11
321 0.11
322 0.1
323 0.09
324 0.11
325 0.11
326 0.09
327 0.1
328 0.1
329 0.1
330 0.11
331 0.11
332 0.09
333 0.1
334 0.1
335 0.07
336 0.08
337 0.07
338 0.06
339 0.05
340 0.05
341 0.05
342 0.04
343 0.03
344 0.02
345 0.02
346 0.02
347 0.02
348 0.03
349 0.03
350 0.03
351 0.04
352 0.05
353 0.05
354 0.05
355 0.06
356 0.07
357 0.11
358 0.13
359 0.18
360 0.22
361 0.25
362 0.26
363 0.33
364 0.4
365 0.45
366 0.53
367 0.59
368 0.65
369 0.71
370 0.78
371 0.78
372 0.75
373 0.73
374 0.72
375 0.67
376 0.6
377 0.54
378 0.48
379 0.41
380 0.44
381 0.38
382 0.28
383 0.22
384 0.19
385 0.17
386 0.18
387 0.2
388 0.12
389 0.14
390 0.17
391 0.16
392 0.17
393 0.17
394 0.17
395 0.21
396 0.23
397 0.23
398 0.27
399 0.28
400 0.33
401 0.34
402 0.36
403 0.37
404 0.43
405 0.53
406 0.54
407 0.61
408 0.6
409 0.67
410 0.65
411 0.68
412 0.67
413 0.64
414 0.66
415 0.68
416 0.67
417 0.59
418 0.61
419 0.56
420 0.52
421 0.48
422 0.4
423 0.37
424 0.4
425 0.47
426 0.45
427 0.47
428 0.49
429 0.52
430 0.6
431 0.65
432 0.68
433 0.7
434 0.78
435 0.84
436 0.88
437 0.91
438 0.91
439 0.91
440 0.88
441 0.85
442 0.82
443 0.78
444 0.78
445 0.77
446 0.72
447 0.67
448 0.64
449 0.6
450 0.63
451 0.65
452 0.66
453 0.67
454 0.73
455 0.75
456 0.82
457 0.81
458 0.76
459 0.7
460 0.61
461 0.57
462 0.55
463 0.55
464 0.52
465 0.51
466 0.46
467 0.44
468 0.4
469 0.34
470 0.25
471 0.18
472 0.12
473 0.1
474 0.1
475 0.12
476 0.13
477 0.13
478 0.13
479 0.13
480 0.16
481 0.17
482 0.17
483 0.18
484 0.19
485 0.19
486 0.21
487 0.24
488 0.22
489 0.21
490 0.21
491 0.19
492 0.2
493 0.19
494 0.18
495 0.19
496 0.16
497 0.14
498 0.14
499 0.12
500 0.1
501 0.12
502 0.13
503 0.12
504 0.18
505 0.2
506 0.26
507 0.33
508 0.36
509 0.37
510 0.39
511 0.41
512 0.41
513 0.4
514 0.38
515 0.32
516 0.3
517 0.27
518 0.23
519 0.18
520 0.13
521 0.14
522 0.1
523 0.08
524 0.11
525 0.14
526 0.15
527 0.18
528 0.24
529 0.3
530 0.31
531 0.32
532 0.3
533 0.28
534 0.27
535 0.26
536 0.21
537 0.12
538 0.11
539 0.12
540 0.12
541 0.13
542 0.14
543 0.17
544 0.26
545 0.29
546 0.33
547 0.42
548 0.49
549 0.55
550 0.61
551 0.64
552 0.64
553 0.65
554 0.64
555 0.59
556 0.55
557 0.52
558 0.46
559 0.41
560 0.38
561 0.44
562 0.46
563 0.46
564 0.44
565 0.46
566 0.53
567 0.56
568 0.55
569 0.48
570 0.48