Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DN66

Protein Details
Accession J9DN66   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-29IHTSKVKKTYRHYKNPIDINNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001969  Aspartic_peptidase_AS  
IPR021109  Peptidase_aspartic_dom_sf  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
PS50158  ZF_CCHC  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MICEKRLFIHTSKVKKTYRHYKNPIDINNIKTKKPFEEITCYKCGQNGHYKNKCFSNVVNNVNEVNDNEARADYRKISIDGKMKQVLFDTGASASFISRDICKELNKQWTPLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.72
4 0.73
5 0.75
6 0.77
7 0.78
8 0.8
9 0.83
10 0.84
11 0.79
12 0.77
13 0.71
14 0.65
15 0.66
16 0.59
17 0.52
18 0.47
19 0.44
20 0.39
21 0.38
22 0.37
23 0.3
24 0.38
25 0.42
26 0.44
27 0.45
28 0.42
29 0.38
30 0.37
31 0.34
32 0.28
33 0.33
34 0.37
35 0.44
36 0.5
37 0.52
38 0.52
39 0.54
40 0.52
41 0.43
42 0.35
43 0.34
44 0.34
45 0.35
46 0.33
47 0.31
48 0.29
49 0.28
50 0.27
51 0.18
52 0.15
53 0.11
54 0.11
55 0.1
56 0.1
57 0.11
58 0.12
59 0.13
60 0.1
61 0.12
62 0.14
63 0.16
64 0.17
65 0.22
66 0.28
67 0.3
68 0.34
69 0.37
70 0.35
71 0.34
72 0.33
73 0.29
74 0.23
75 0.21
76 0.16
77 0.12
78 0.12
79 0.12
80 0.11
81 0.09
82 0.07
83 0.08
84 0.09
85 0.1
86 0.12
87 0.15
88 0.19
89 0.23
90 0.29
91 0.35
92 0.44
93 0.46