Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZYR1

Protein Details
Accession A0A178ZYR1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-104SILFIRHKRTRRTQYQWVSQADHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6, plas 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTVLRASILITVVASGPTLSVSASGPPATRTSTAATTATTTAHFTPSLPAVPPLPASTSMGPTLFGGLAIGSIATMAGVTIASILFIRHKRTRRTQYQWVSQADPARLRVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.07
10 0.09
11 0.1
12 0.1
13 0.11
14 0.13
15 0.14
16 0.15
17 0.15
18 0.17
19 0.17
20 0.19
21 0.18
22 0.17
23 0.16
24 0.16
25 0.14
26 0.12
27 0.12
28 0.1
29 0.11
30 0.11
31 0.1
32 0.11
33 0.11
34 0.11
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.09
41 0.09
42 0.09
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.09
50 0.09
51 0.07
52 0.06
53 0.05
54 0.04
55 0.04
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.03
71 0.04
72 0.09
73 0.12
74 0.2
75 0.27
76 0.35
77 0.43
78 0.54
79 0.64
80 0.69
81 0.75
82 0.79
83 0.81
84 0.84
85 0.84
86 0.77
87 0.7
88 0.64
89 0.61
90 0.55
91 0.49
92 0.41