Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9D607

Protein Details
Accession J9D607    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
104-130VARNINKKIEKCKKKYHNEEKLSQWRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR004640  HscB  
IPR036869  J_dom_sf  
Gene Ontology GO:0001671  F:ATPase activator activity  
GO:0051087  F:protein-folding chaperone binding  
GO:0044571  P:[2Fe-2S] cluster assembly  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MLKERNFFKMFDIEPIFNINQKYLQKKYHQMSKIYHPDLQKSETKFQELQNAYNTLKNDYNRAVYLKQLEKGKFESHVNEKFLNKILTMEEHIENTDASKLDEVARNINKKIEKCKKKYHNEEKLSQWRYYQRLSDLISKKQEAEELKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.33
4 0.29
5 0.29
6 0.22
7 0.23
8 0.28
9 0.34
10 0.35
11 0.41
12 0.45
13 0.53
14 0.59
15 0.63
16 0.63
17 0.62
18 0.61
19 0.64
20 0.67
21 0.61
22 0.58
23 0.5
24 0.51
25 0.48
26 0.47
27 0.43
28 0.38
29 0.42
30 0.39
31 0.42
32 0.39
33 0.37
34 0.42
35 0.38
36 0.36
37 0.32
38 0.34
39 0.3
40 0.3
41 0.29
42 0.23
43 0.25
44 0.23
45 0.23
46 0.21
47 0.23
48 0.21
49 0.23
50 0.2
51 0.18
52 0.23
53 0.22
54 0.24
55 0.28
56 0.27
57 0.27
58 0.29
59 0.28
60 0.25
61 0.24
62 0.24
63 0.25
64 0.28
65 0.29
66 0.29
67 0.28
68 0.27
69 0.28
70 0.25
71 0.18
72 0.15
73 0.13
74 0.12
75 0.13
76 0.15
77 0.13
78 0.12
79 0.12
80 0.12
81 0.11
82 0.1
83 0.1
84 0.08
85 0.08
86 0.08
87 0.08
88 0.1
89 0.14
90 0.15
91 0.21
92 0.26
93 0.29
94 0.3
95 0.35
96 0.37
97 0.38
98 0.48
99 0.51
100 0.56
101 0.6
102 0.71
103 0.76
104 0.82
105 0.89
106 0.89
107 0.89
108 0.86
109 0.85
110 0.84
111 0.84
112 0.77
113 0.67
114 0.61
115 0.58
116 0.55
117 0.53
118 0.47
119 0.41
120 0.42
121 0.44
122 0.49
123 0.47
124 0.5
125 0.52
126 0.5
127 0.47
128 0.43
129 0.45