Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8ZX15

Protein Details
Accession J8ZX15    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-60TPNKLIPKKREHRNLEKRRSPLBasic
NLS Segment(s)
PositionSequence
46-56KKREHRNLEKR
Subcellular Location(s) nucl 12, mito 8.5, cyto_nucl 8.333, cyto_mito 6.166, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MFIVDPFYILYDIVVNNIVQEWSLTLNCSSLFVCSSFLTPNKLIPKKREHRNLEKRRSPLQMHAFSTAPSNKKNVHNYHFFLKFLNSYVPIMFIQKVTDIYYKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.09
5 0.08
6 0.06
7 0.06
8 0.06
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.11
16 0.1
17 0.08
18 0.09
19 0.08
20 0.1
21 0.1
22 0.11
23 0.12
24 0.13
25 0.17
26 0.16
27 0.21
28 0.28
29 0.33
30 0.36
31 0.39
32 0.49
33 0.54
34 0.63
35 0.68
36 0.67
37 0.72
38 0.8
39 0.85
40 0.84
41 0.82
42 0.77
43 0.72
44 0.7
45 0.61
46 0.58
47 0.56
48 0.52
49 0.47
50 0.45
51 0.4
52 0.34
53 0.36
54 0.32
55 0.26
56 0.22
57 0.24
58 0.26
59 0.33
60 0.42
61 0.45
62 0.46
63 0.51
64 0.53
65 0.57
66 0.54
67 0.47
68 0.4
69 0.35
70 0.3
71 0.25
72 0.25
73 0.19
74 0.18
75 0.18
76 0.19
77 0.17
78 0.18
79 0.17
80 0.15
81 0.14
82 0.14
83 0.16
84 0.17
85 0.23