Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZWU4

Protein Details
Accession A0A178ZWU4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-66HTETWLERHRRKQRRTRIIGCIIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAANVRDPAFWRRFSMAVHLDEEKANISDTRSTSTTSSTAPLRHTETWLERHRRKQRRTRIIGCIIALGFIAVIVAVVMVLLWFAKVGPFKDQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.34
4 0.32
5 0.33
6 0.3
7 0.28
8 0.27
9 0.26
10 0.2
11 0.15
12 0.13
13 0.11
14 0.11
15 0.14
16 0.15
17 0.18
18 0.17
19 0.18
20 0.18
21 0.19
22 0.19
23 0.16
24 0.17
25 0.16
26 0.17
27 0.17
28 0.19
29 0.21
30 0.21
31 0.21
32 0.22
33 0.23
34 0.29
35 0.35
36 0.41
37 0.41
38 0.5
39 0.59
40 0.66
41 0.73
42 0.76
43 0.79
44 0.82
45 0.86
46 0.83
47 0.82
48 0.78
49 0.71
50 0.61
51 0.52
52 0.4
53 0.31
54 0.23
55 0.14
56 0.07
57 0.05
58 0.04
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.03
72 0.06
73 0.1
74 0.12
75 0.18