Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZMV1

Protein Details
Accession A0A178ZMV1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
317-340EKEGRGDRRQNRQGGQRQNRTESFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_mito 10.999, cyto_nucl 9.833, mito 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027531  eIF3f  
IPR000555  JAMM/MPN+_dom  
IPR037518  MPN  
IPR024969  Rpn11/EIF3F_C  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0008237  F:metallopeptidase activity  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
Pfam View protein in Pfam  
PF01398  JAB  
PF13012  MitMem_reg  
PROSITE View protein in PROSITE  
PS50249  MPN  
CDD cd08064  MPN_eIF3f  
Amino Acid Sequences MAEQDAFLHLTRPLGPVAVGAQPTTAPLRVVIQPQALFSILDHCIRRPPDQQRVIGTLLGTRSDADESQIVVHSSFAVSHTETTDQVEVDMEYQKAMLALHLRASPKEVLVGWYATSSELNTFSALIQNHYSSQGEGTFPYPAVHITVSCQPGQDIEVRTYISSPVGVSPERAADSAAFIPIPYTVNYGEADRAGLEAIGYAKESESRTATILTEIESLEKSLEDTLGMLDRVAKYVENVIEEETEPSTALGQFLLNTLALAPKVDPAEIEKDFNNHVQDVLTVSYLANMIRTQMDLSNRLATSALTMGGGESGSTEKEGRGDRRQNRQGGQRQNRTESFSVANV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.15
5 0.16
6 0.15
7 0.14
8 0.14
9 0.13
10 0.15
11 0.17
12 0.15
13 0.11
14 0.12
15 0.15
16 0.19
17 0.22
18 0.24
19 0.26
20 0.26
21 0.26
22 0.27
23 0.24
24 0.2
25 0.17
26 0.18
27 0.15
28 0.2
29 0.2
30 0.2
31 0.26
32 0.29
33 0.34
34 0.38
35 0.46
36 0.52
37 0.58
38 0.61
39 0.59
40 0.6
41 0.56
42 0.48
43 0.39
44 0.31
45 0.25
46 0.21
47 0.17
48 0.13
49 0.12
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.13
56 0.14
57 0.13
58 0.11
59 0.11
60 0.09
61 0.08
62 0.08
63 0.08
64 0.09
65 0.09
66 0.1
67 0.11
68 0.12
69 0.13
70 0.15
71 0.15
72 0.13
73 0.12
74 0.12
75 0.1
76 0.1
77 0.12
78 0.1
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.11
88 0.15
89 0.16
90 0.15
91 0.19
92 0.18
93 0.15
94 0.16
95 0.14
96 0.13
97 0.14
98 0.14
99 0.11
100 0.1
101 0.11
102 0.09
103 0.09
104 0.08
105 0.07
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.12
112 0.11
113 0.12
114 0.12
115 0.13
116 0.13
117 0.14
118 0.15
119 0.11
120 0.11
121 0.11
122 0.1
123 0.1
124 0.1
125 0.09
126 0.09
127 0.09
128 0.08
129 0.08
130 0.08
131 0.08
132 0.07
133 0.08
134 0.13
135 0.15
136 0.15
137 0.14
138 0.13
139 0.13
140 0.14
141 0.16
142 0.13
143 0.12
144 0.13
145 0.13
146 0.14
147 0.14
148 0.13
149 0.09
150 0.07
151 0.06
152 0.06
153 0.08
154 0.08
155 0.08
156 0.08
157 0.09
158 0.09
159 0.09
160 0.08
161 0.07
162 0.08
163 0.08
164 0.08
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.06
171 0.07
172 0.07
173 0.08
174 0.09
175 0.09
176 0.09
177 0.08
178 0.08
179 0.06
180 0.06
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.07
191 0.08
192 0.09
193 0.11
194 0.11
195 0.12
196 0.13
197 0.13
198 0.11
199 0.11
200 0.1
201 0.1
202 0.09
203 0.09
204 0.09
205 0.09
206 0.08
207 0.07
208 0.07
209 0.06
210 0.06
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.06
217 0.08
218 0.08
219 0.09
220 0.09
221 0.08
222 0.08
223 0.12
224 0.13
225 0.12
226 0.12
227 0.12
228 0.13
229 0.13
230 0.14
231 0.11
232 0.1
233 0.09
234 0.08
235 0.08
236 0.07
237 0.07
238 0.06
239 0.06
240 0.06
241 0.06
242 0.07
243 0.06
244 0.06
245 0.06
246 0.07
247 0.06
248 0.07
249 0.07
250 0.09
251 0.09
252 0.09
253 0.09
254 0.12
255 0.17
256 0.18
257 0.2
258 0.18
259 0.2
260 0.22
261 0.25
262 0.24
263 0.19
264 0.18
265 0.16
266 0.16
267 0.15
268 0.14
269 0.11
270 0.09
271 0.08
272 0.09
273 0.09
274 0.09
275 0.08
276 0.07
277 0.09
278 0.09
279 0.1
280 0.11
281 0.14
282 0.18
283 0.19
284 0.22
285 0.26
286 0.25
287 0.25
288 0.24
289 0.2
290 0.19
291 0.17
292 0.14
293 0.08
294 0.08
295 0.08
296 0.08
297 0.08
298 0.05
299 0.05
300 0.06
301 0.07
302 0.09
303 0.09
304 0.09
305 0.14
306 0.21
307 0.27
308 0.37
309 0.47
310 0.54
311 0.64
312 0.73
313 0.76
314 0.76
315 0.8
316 0.79
317 0.8
318 0.83
319 0.82
320 0.81
321 0.81
322 0.77
323 0.74
324 0.66
325 0.59