Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178Z400

Protein Details
Accession A0A178Z400    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-40GRLLCRLVRPMQKNRPRRSTFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
CDD cd02947  TRX_family  
Amino Acid Sequences MASNLKDPSPDLLIADCGGRLLCRLVRPMQKNRPRRSTFSATTLSTTQDHLRKIDTHKLQDNARSYGIRARPTFMVSKNTRPVRTIQGADREALSHTVKELASAARQADPASFSSSRSPAVLSRPCSGSTDTPRLYRAAEWLSPTTPGKGALEVPEDDQDDGGLKAVECRSNIFAAKPPDNFENRMMIKPKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.12
4 0.09
5 0.09
6 0.08
7 0.08
8 0.1
9 0.13
10 0.15
11 0.2
12 0.27
13 0.36
14 0.44
15 0.54
16 0.61
17 0.68
18 0.76
19 0.81
20 0.84
21 0.81
22 0.8
23 0.78
24 0.76
25 0.7
26 0.66
27 0.61
28 0.52
29 0.49
30 0.42
31 0.36
32 0.28
33 0.26
34 0.25
35 0.25
36 0.25
37 0.23
38 0.25
39 0.27
40 0.31
41 0.39
42 0.39
43 0.41
44 0.45
45 0.48
46 0.48
47 0.5
48 0.49
49 0.42
50 0.38
51 0.33
52 0.28
53 0.31
54 0.32
55 0.31
56 0.28
57 0.28
58 0.26
59 0.29
60 0.32
61 0.27
62 0.32
63 0.29
64 0.35
65 0.41
66 0.45
67 0.43
68 0.41
69 0.41
70 0.39
71 0.4
72 0.36
73 0.31
74 0.33
75 0.33
76 0.32
77 0.29
78 0.23
79 0.19
80 0.19
81 0.16
82 0.09
83 0.08
84 0.1
85 0.1
86 0.09
87 0.1
88 0.08
89 0.08
90 0.09
91 0.1
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.1
98 0.14
99 0.13
100 0.14
101 0.16
102 0.17
103 0.17
104 0.16
105 0.16
106 0.13
107 0.2
108 0.24
109 0.25
110 0.26
111 0.27
112 0.28
113 0.29
114 0.3
115 0.29
116 0.3
117 0.34
118 0.34
119 0.34
120 0.34
121 0.33
122 0.32
123 0.26
124 0.24
125 0.2
126 0.2
127 0.22
128 0.22
129 0.22
130 0.24
131 0.24
132 0.21
133 0.18
134 0.18
135 0.16
136 0.15
137 0.16
138 0.15
139 0.18
140 0.17
141 0.18
142 0.19
143 0.19
144 0.18
145 0.16
146 0.14
147 0.12
148 0.11
149 0.1
150 0.08
151 0.07
152 0.11
153 0.14
154 0.17
155 0.16
156 0.19
157 0.21
158 0.24
159 0.25
160 0.23
161 0.27
162 0.32
163 0.37
164 0.36
165 0.38
166 0.41
167 0.44
168 0.45
169 0.41
170 0.43
171 0.4
172 0.46