Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8ZWK3

Protein Details
Accession J8ZWK3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
145-167SDRLRALKDKLHKTKKGKDIKKLBasic
NLS Segment(s)
PositionSequence
151-167LKDKLHKTKKGKDIKKL
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLFSNSSFFRITFFLLFKQNKTTQNLQILYLEREINNLTTTLKDIEQKINKKIEPLKKEFKVDIRVENLKSQIEEQIETFWTASNLPRIKFKSKKFNYLSELEKVYSDEKYQGTQESEDNKNLKIKFAEILGKDPECFFQYVDLSDRLRALKDKLHKTKKGKDIKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.32
4 0.32
5 0.38
6 0.42
7 0.45
8 0.49
9 0.52
10 0.5
11 0.56
12 0.55
13 0.48
14 0.46
15 0.42
16 0.38
17 0.34
18 0.29
19 0.2
20 0.21
21 0.2
22 0.17
23 0.15
24 0.13
25 0.12
26 0.1
27 0.12
28 0.12
29 0.13
30 0.16
31 0.18
32 0.26
33 0.33
34 0.38
35 0.42
36 0.47
37 0.46
38 0.49
39 0.54
40 0.54
41 0.54
42 0.57
43 0.6
44 0.57
45 0.61
46 0.57
47 0.54
48 0.54
49 0.48
50 0.44
51 0.4
52 0.41
53 0.38
54 0.38
55 0.34
56 0.26
57 0.24
58 0.21
59 0.19
60 0.15
61 0.14
62 0.12
63 0.12
64 0.12
65 0.12
66 0.11
67 0.08
68 0.07
69 0.07
70 0.08
71 0.13
72 0.15
73 0.15
74 0.2
75 0.24
76 0.32
77 0.39
78 0.44
79 0.49
80 0.51
81 0.6
82 0.59
83 0.61
84 0.57
85 0.54
86 0.51
87 0.43
88 0.41
89 0.31
90 0.28
91 0.23
92 0.2
93 0.16
94 0.14
95 0.14
96 0.13
97 0.14
98 0.15
99 0.16
100 0.17
101 0.17
102 0.2
103 0.22
104 0.25
105 0.28
106 0.29
107 0.28
108 0.32
109 0.31
110 0.31
111 0.26
112 0.24
113 0.21
114 0.23
115 0.27
116 0.22
117 0.26
118 0.27
119 0.27
120 0.26
121 0.25
122 0.24
123 0.2
124 0.19
125 0.16
126 0.15
127 0.15
128 0.17
129 0.19
130 0.21
131 0.2
132 0.21
133 0.23
134 0.21
135 0.22
136 0.23
137 0.23
138 0.27
139 0.36
140 0.46
141 0.54
142 0.63
143 0.7
144 0.77
145 0.83
146 0.86
147 0.88