Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8ZVS5

Protein Details
Accession J8ZVS5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
233-256IESLLRQRRGRRLCDYNKRTKKNDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 5.5, pero 4, cyto_nucl 3.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007599  DER1  
IPR035952  Rhomboid-like_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006950  P:response to stress  
Pfam View protein in Pfam  
PF04511  DER1  
Amino Acid Sequences MKKVAISLIYTNIPNNFNTLFKKMDTYNQIPPATRTIITASVALPLIGFIMPNLSRYLYFSIYDLKRLKIHQLLTGIFIQQLDLNLFFRILSRYLVLMQLENNSFTLPGLKIAEELIFYTSTFAIPLFISNLFFRMFTFAPLLNTSYVTLQCFVFPKDYEVMFYGIKMNMLQFLVAYLVFEFLVSRGSFEFLVGFLYGLLYYFLRTKIKASHRYILICKGKLLNFCFFAKYKIESLLRQRRGRRLCDYNKRTKKND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.23
5 0.27
6 0.28
7 0.27
8 0.26
9 0.3
10 0.28
11 0.35
12 0.39
13 0.4
14 0.44
15 0.49
16 0.51
17 0.48
18 0.48
19 0.45
20 0.4
21 0.35
22 0.28
23 0.23
24 0.23
25 0.23
26 0.22
27 0.17
28 0.16
29 0.15
30 0.14
31 0.1
32 0.08
33 0.08
34 0.06
35 0.06
36 0.04
37 0.08
38 0.09
39 0.1
40 0.11
41 0.11
42 0.11
43 0.14
44 0.18
45 0.15
46 0.15
47 0.15
48 0.23
49 0.23
50 0.3
51 0.29
52 0.29
53 0.3
54 0.31
55 0.36
56 0.33
57 0.34
58 0.31
59 0.33
60 0.31
61 0.3
62 0.3
63 0.24
64 0.19
65 0.17
66 0.13
67 0.1
68 0.1
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.1
82 0.12
83 0.11
84 0.1
85 0.1
86 0.12
87 0.12
88 0.11
89 0.11
90 0.09
91 0.09
92 0.08
93 0.09
94 0.07
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.07
117 0.07
118 0.08
119 0.08
120 0.08
121 0.07
122 0.1
123 0.1
124 0.09
125 0.11
126 0.1
127 0.11
128 0.12
129 0.13
130 0.1
131 0.11
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.09
138 0.1
139 0.11
140 0.11
141 0.12
142 0.12
143 0.14
144 0.15
145 0.15
146 0.15
147 0.15
148 0.16
149 0.13
150 0.13
151 0.13
152 0.11
153 0.11
154 0.1
155 0.09
156 0.09
157 0.09
158 0.08
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.04
165 0.05
166 0.05
167 0.05
168 0.05
169 0.04
170 0.07
171 0.07
172 0.08
173 0.08
174 0.09
175 0.09
176 0.09
177 0.09
178 0.07
179 0.08
180 0.07
181 0.07
182 0.05
183 0.06
184 0.05
185 0.05
186 0.06
187 0.05
188 0.06
189 0.08
190 0.11
191 0.13
192 0.14
193 0.16
194 0.24
195 0.34
196 0.43
197 0.48
198 0.52
199 0.55
200 0.6
201 0.61
202 0.62
203 0.6
204 0.51
205 0.48
206 0.45
207 0.44
208 0.45
209 0.46
210 0.41
211 0.37
212 0.37
213 0.39
214 0.34
215 0.34
216 0.31
217 0.31
218 0.28
219 0.32
220 0.34
221 0.36
222 0.46
223 0.54
224 0.59
225 0.64
226 0.69
227 0.72
228 0.76
229 0.77
230 0.76
231 0.76
232 0.78
233 0.81
234 0.83
235 0.85
236 0.87