Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DSS4

Protein Details
Accession J9DSS4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-70TNNLTKSSKKDNKTKNKKAKVNKEKADDHydrophilic
NLS Segment(s)
PositionSequence
51-65KKDNKTKNKKAKVNK
Subcellular Location(s) nucl 14.5, cyto_nucl 13.833, cyto 10, cyto_pero 5.999
Family & Domain DBs
Amino Acid Sequences MLKYNDSTSVEDTSASSECEFSDITDNNLVKKKSHSNLSSINTNNLTKSSKKDNKTKNKKAKVNKEKADDNKNSTIEEDEEKLRNIEALKNFFSELVGYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.11
5 0.1
6 0.12
7 0.11
8 0.1
9 0.15
10 0.14
11 0.16
12 0.21
13 0.22
14 0.24
15 0.29
16 0.29
17 0.24
18 0.29
19 0.34
20 0.33
21 0.41
22 0.39
23 0.39
24 0.46
25 0.48
26 0.49
27 0.42
28 0.4
29 0.34
30 0.33
31 0.29
32 0.23
33 0.22
34 0.17
35 0.2
36 0.27
37 0.32
38 0.38
39 0.46
40 0.55
41 0.64
42 0.74
43 0.81
44 0.81
45 0.84
46 0.87
47 0.88
48 0.89
49 0.89
50 0.88
51 0.85
52 0.8
53 0.78
54 0.77
55 0.76
56 0.7
57 0.65
58 0.61
59 0.54
60 0.49
61 0.41
62 0.36
63 0.28
64 0.26
65 0.23
66 0.2
67 0.21
68 0.21
69 0.21
70 0.19
71 0.19
72 0.18
73 0.22
74 0.25
75 0.28
76 0.29
77 0.3
78 0.3
79 0.28
80 0.27