Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D9Y3

Protein Details
Accession J9D9Y3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
89-108LYYYRQKKFVKKREEEEVSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences KPLNCISNGNNIKDNINKINSHKLFQNASSSPINPICSIIKFTQIQRLIIPEDPIWTDYEHNEFLKLVKSKNFSQISNILKKNMKNVVLYYYRQKKFVKKREEEEVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.39
4 0.39
5 0.38
6 0.48
7 0.46
8 0.44
9 0.42
10 0.41
11 0.39
12 0.37
13 0.4
14 0.29
15 0.32
16 0.32
17 0.29
18 0.28
19 0.27
20 0.27
21 0.2
22 0.21
23 0.18
24 0.17
25 0.2
26 0.17
27 0.2
28 0.2
29 0.21
30 0.27
31 0.27
32 0.27
33 0.23
34 0.25
35 0.22
36 0.21
37 0.21
38 0.13
39 0.12
40 0.12
41 0.12
42 0.11
43 0.1
44 0.1
45 0.09
46 0.12
47 0.13
48 0.12
49 0.12
50 0.11
51 0.11
52 0.17
53 0.18
54 0.17
55 0.2
56 0.24
57 0.26
58 0.35
59 0.38
60 0.32
61 0.35
62 0.4
63 0.42
64 0.46
65 0.45
66 0.41
67 0.43
68 0.43
69 0.46
70 0.45
71 0.41
72 0.35
73 0.35
74 0.37
75 0.38
76 0.4
77 0.43
78 0.47
79 0.46
80 0.5
81 0.54
82 0.57
83 0.64
84 0.71
85 0.72
86 0.71
87 0.75
88 0.79