Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZU83

Protein Details
Accession A0A178ZU83    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-55AITSKRGNKVKKNAEPNNPAHydrophilic
128-173AEGKTVKKQKKEPTKKSGGAPKKAEEKKEEKKEEPKKTAGRPKKAEBasic
NLS Segment(s)
PositionSequence
131-182KTVKKQKKEPTKKSGGAPKKAEEKKEEKKEEPKKTAGRPKKAEGALAKQKKQ
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MSTSEEPEKGDKVTWNWGGGKPGGTVAEKKTEGEVAITSKRGNKVKKNAEPNNPAVHIERSGQDVVKKASELQVEEKANGDTGAAKADGKKEGSTEAETKNGEKRKHDDAEKEEDDKPDKASPLEENAEGKTVKKQKKEPTKKSGGAPKKAEEKKEEKKEEPKKTAGRPKKAEGALAKQKKQATPRATDGIGSRTRSQQKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.36
4 0.37
5 0.38
6 0.35
7 0.33
8 0.25
9 0.24
10 0.22
11 0.21
12 0.22
13 0.21
14 0.27
15 0.26
16 0.26
17 0.26
18 0.24
19 0.23
20 0.21
21 0.19
22 0.16
23 0.18
24 0.19
25 0.19
26 0.22
27 0.29
28 0.35
29 0.41
30 0.46
31 0.54
32 0.63
33 0.71
34 0.77
35 0.79
36 0.81
37 0.8
38 0.75
39 0.7
40 0.61
41 0.53
42 0.45
43 0.38
44 0.3
45 0.25
46 0.21
47 0.19
48 0.19
49 0.18
50 0.17
51 0.19
52 0.19
53 0.18
54 0.18
55 0.15
56 0.18
57 0.18
58 0.19
59 0.19
60 0.24
61 0.23
62 0.23
63 0.24
64 0.2
65 0.18
66 0.16
67 0.13
68 0.07
69 0.06
70 0.07
71 0.06
72 0.07
73 0.08
74 0.09
75 0.11
76 0.11
77 0.12
78 0.11
79 0.12
80 0.14
81 0.15
82 0.17
83 0.16
84 0.18
85 0.18
86 0.18
87 0.23
88 0.27
89 0.26
90 0.26
91 0.29
92 0.34
93 0.39
94 0.41
95 0.41
96 0.4
97 0.46
98 0.45
99 0.45
100 0.39
101 0.36
102 0.35
103 0.3
104 0.28
105 0.21
106 0.2
107 0.17
108 0.17
109 0.16
110 0.18
111 0.19
112 0.18
113 0.17
114 0.16
115 0.18
116 0.17
117 0.16
118 0.2
119 0.27
120 0.32
121 0.37
122 0.45
123 0.53
124 0.64
125 0.75
126 0.77
127 0.78
128 0.82
129 0.79
130 0.79
131 0.79
132 0.77
133 0.74
134 0.69
135 0.64
136 0.65
137 0.65
138 0.62
139 0.59
140 0.6
141 0.62
142 0.68
143 0.7
144 0.66
145 0.72
146 0.78
147 0.81
148 0.78
149 0.77
150 0.74
151 0.77
152 0.81
153 0.8
154 0.8
155 0.77
156 0.76
157 0.76
158 0.69
159 0.66
160 0.6
161 0.6
162 0.61
163 0.63
164 0.61
165 0.57
166 0.61
167 0.6
168 0.61
169 0.61
170 0.57
171 0.56
172 0.58
173 0.58
174 0.54
175 0.51
176 0.46
177 0.44
178 0.43
179 0.4
180 0.37
181 0.4
182 0.49