Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D899

Protein Details
Accession J9D899    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-103IDIHNESNRKHRRRTKNKTSDSFQIAHydrophilic
NLS Segment(s)
PositionSequence
87-91KHRRR
Subcellular Location(s) nucl 6.5, mito 6, cyto_nucl 5, plas 4, pero 3, cyto 2.5, extr 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKISFANFFGVLCLLLALNFFMIKSMPYCNLNKIAIGKKYEKTSINSIPKSTYGKKNILPKPNFHDNDSLKWLNSSHIDIHNESNRKHRRRTKNKTSDSFQIASDPSMSSIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.09
13 0.12
14 0.16
15 0.18
16 0.21
17 0.25
18 0.24
19 0.25
20 0.28
21 0.31
22 0.31
23 0.34
24 0.35
25 0.34
26 0.37
27 0.39
28 0.37
29 0.35
30 0.37
31 0.42
32 0.46
33 0.44
34 0.42
35 0.38
36 0.38
37 0.4
38 0.38
39 0.36
40 0.33
41 0.36
42 0.39
43 0.47
44 0.51
45 0.56
46 0.53
47 0.5
48 0.51
49 0.58
50 0.55
51 0.47
52 0.49
53 0.41
54 0.43
55 0.46
56 0.39
57 0.29
58 0.28
59 0.27
60 0.21
61 0.21
62 0.19
63 0.16
64 0.19
65 0.22
66 0.23
67 0.28
68 0.33
69 0.35
70 0.34
71 0.41
72 0.47
73 0.51
74 0.59
75 0.64
76 0.69
77 0.76
78 0.86
79 0.87
80 0.89
81 0.93
82 0.91
83 0.87
84 0.83
85 0.79
86 0.69
87 0.58
88 0.51
89 0.42
90 0.34
91 0.29
92 0.22