Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178Z489

Protein Details
Accession A0A178Z489    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
254-276EETLYKRQVRRVMQRRNRLHMLLHydrophilic
NLS Segment(s)
PositionSequence
289-304RVIRSRAIRTSSHRRR
Subcellular Location(s) cyto 8, mito 7, cyto_nucl 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036280  Multihaem_cyt_sf  
Amino Acid Sequences MATTQNAFVALPAEVHGTIGAYLPLDSLMSVRSTCKTLYASAGYCRETVKELHRVDDETKVATQKCENWSPPGCGMMLAIGDYAPTRNRFLVANWRSWAARKGLSALAAHWASDRKFMRLCCDSCATMKLLAAFPSEEVRSRKRDKQSVTWMDIRRWNPDPKNKRAGAAETATQGVSFVRQCGECKIHLGYEGWVTLGPFELDRIIRCATCHEDKWMATDDPRGTKWLLAGKECFECHIKRPEYQGFYALVKHEETLYKRQVRRVMQRRNRLHMLLNRDKPISVAEAKRVIRSRAIRTSSHRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.09
6 0.09
7 0.08
8 0.06
9 0.06
10 0.06
11 0.07
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.09
18 0.11
19 0.12
20 0.14
21 0.15
22 0.18
23 0.19
24 0.19
25 0.23
26 0.26
27 0.26
28 0.3
29 0.34
30 0.31
31 0.3
32 0.29
33 0.26
34 0.23
35 0.25
36 0.26
37 0.31
38 0.31
39 0.34
40 0.35
41 0.37
42 0.37
43 0.38
44 0.33
45 0.26
46 0.27
47 0.28
48 0.27
49 0.26
50 0.27
51 0.27
52 0.31
53 0.36
54 0.36
55 0.39
56 0.41
57 0.43
58 0.41
59 0.36
60 0.3
61 0.23
62 0.21
63 0.15
64 0.11
65 0.08
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06
71 0.08
72 0.1
73 0.12
74 0.12
75 0.14
76 0.14
77 0.17
78 0.27
79 0.27
80 0.3
81 0.29
82 0.3
83 0.3
84 0.31
85 0.32
86 0.24
87 0.23
88 0.19
89 0.21
90 0.21
91 0.22
92 0.2
93 0.17
94 0.19
95 0.16
96 0.16
97 0.14
98 0.15
99 0.13
100 0.21
101 0.21
102 0.19
103 0.22
104 0.23
105 0.28
106 0.32
107 0.33
108 0.29
109 0.31
110 0.29
111 0.27
112 0.28
113 0.23
114 0.17
115 0.17
116 0.15
117 0.13
118 0.12
119 0.12
120 0.1
121 0.09
122 0.1
123 0.1
124 0.12
125 0.15
126 0.18
127 0.24
128 0.29
129 0.36
130 0.42
131 0.48
132 0.49
133 0.54
134 0.61
135 0.61
136 0.6
137 0.6
138 0.54
139 0.5
140 0.52
141 0.45
142 0.39
143 0.37
144 0.4
145 0.39
146 0.47
147 0.52
148 0.53
149 0.61
150 0.56
151 0.55
152 0.49
153 0.46
154 0.4
155 0.33
156 0.28
157 0.2
158 0.2
159 0.17
160 0.15
161 0.12
162 0.08
163 0.08
164 0.07
165 0.06
166 0.07
167 0.08
168 0.09
169 0.13
170 0.16
171 0.14
172 0.17
173 0.17
174 0.16
175 0.17
176 0.17
177 0.14
178 0.13
179 0.12
180 0.1
181 0.09
182 0.09
183 0.07
184 0.07
185 0.06
186 0.05
187 0.05
188 0.07
189 0.07
190 0.08
191 0.11
192 0.12
193 0.12
194 0.12
195 0.15
196 0.19
197 0.23
198 0.24
199 0.25
200 0.28
201 0.27
202 0.3
203 0.31
204 0.26
205 0.23
206 0.28
207 0.27
208 0.27
209 0.28
210 0.27
211 0.23
212 0.23
213 0.25
214 0.25
215 0.24
216 0.24
217 0.25
218 0.26
219 0.29
220 0.28
221 0.27
222 0.26
223 0.25
224 0.28
225 0.36
226 0.36
227 0.35
228 0.43
229 0.48
230 0.49
231 0.48
232 0.45
233 0.38
234 0.36
235 0.36
236 0.3
237 0.24
238 0.19
239 0.18
240 0.17
241 0.2
242 0.23
243 0.29
244 0.37
245 0.44
246 0.46
247 0.52
248 0.58
249 0.62
250 0.69
251 0.71
252 0.74
253 0.75
254 0.82
255 0.85
256 0.85
257 0.82
258 0.74
259 0.72
260 0.67
261 0.67
262 0.67
263 0.65
264 0.61
265 0.56
266 0.53
267 0.45
268 0.41
269 0.36
270 0.33
271 0.3
272 0.32
273 0.39
274 0.4
275 0.47
276 0.5
277 0.47
278 0.48
279 0.52
280 0.54
281 0.56
282 0.59
283 0.58
284 0.62