Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZZ16

Protein Details
Accession A0A178ZZ16    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-47HGKPVKWDRIRRFSRPPPQAQKRTRRTAAGHydrophilic
NLS Segment(s)
PositionSequence
28-40RRFSRPPPQAQKR
Subcellular Location(s) nucl 17, mito_nucl 11.999, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MTTRSASTEEATPLVQLHGKPVKWDRIRRFSRPPPQAQKRTRRTAAGVSPIGERIHLDLHPNAFRSTVDIDERILFLTKSYLDWNFSFWTSLGFAQRQQQRRDLSNLKCQSGNDVSRVFNKCFYNAIPLLFTNNTVEAFKEINLACSLASHCIQKSPYWIFLRLLHLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.14
4 0.2
5 0.25
6 0.25
7 0.31
8 0.37
9 0.46
10 0.51
11 0.61
12 0.63
13 0.67
14 0.74
15 0.75
16 0.79
17 0.79
18 0.81
19 0.81
20 0.81
21 0.82
22 0.85
23 0.88
24 0.88
25 0.88
26 0.87
27 0.87
28 0.81
29 0.74
30 0.67
31 0.64
32 0.59
33 0.56
34 0.48
35 0.39
36 0.36
37 0.34
38 0.3
39 0.23
40 0.17
41 0.11
42 0.12
43 0.11
44 0.13
45 0.13
46 0.16
47 0.18
48 0.19
49 0.18
50 0.16
51 0.16
52 0.15
53 0.15
54 0.14
55 0.14
56 0.13
57 0.13
58 0.13
59 0.13
60 0.11
61 0.1
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.11
70 0.11
71 0.13
72 0.13
73 0.13
74 0.13
75 0.11
76 0.11
77 0.09
78 0.11
79 0.11
80 0.1
81 0.12
82 0.18
83 0.25
84 0.3
85 0.31
86 0.36
87 0.38
88 0.4
89 0.46
90 0.47
91 0.46
92 0.5
93 0.51
94 0.47
95 0.45
96 0.41
97 0.39
98 0.38
99 0.35
100 0.28
101 0.26
102 0.26
103 0.31
104 0.35
105 0.31
106 0.3
107 0.3
108 0.28
109 0.28
110 0.27
111 0.27
112 0.25
113 0.25
114 0.21
115 0.2
116 0.22
117 0.2
118 0.2
119 0.15
120 0.15
121 0.15
122 0.13
123 0.14
124 0.12
125 0.13
126 0.12
127 0.16
128 0.15
129 0.16
130 0.17
131 0.16
132 0.14
133 0.14
134 0.15
135 0.14
136 0.15
137 0.16
138 0.16
139 0.21
140 0.22
141 0.23
142 0.29
143 0.3
144 0.37
145 0.38
146 0.41
147 0.39
148 0.42
149 0.47