Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8ZR28

Protein Details
Accession J8ZR28    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
101-133ATNSVRATNCRKKSKCGRSTKLRPKKQKKKAKKHydrophilic
NLS Segment(s)
PositionSequence
112-133KKSKCGRSTKLRPKKQKKKAKK
Subcellular Location(s) nucl 14, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MQIIINHPNNRKETLTITETSISSLFALIQASVNIKAAQFKATFSGKLLDKTSSFNTNDLGIKNGSTIDVTLKCLGGDLNETDRQALLERNNKTVCRVCYATNSVRATNCRKKSKCGRSTKLRPKKQKKKAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.33
4 0.33
5 0.31
6 0.29
7 0.28
8 0.23
9 0.17
10 0.13
11 0.12
12 0.09
13 0.07
14 0.08
15 0.06
16 0.07
17 0.07
18 0.08
19 0.09
20 0.1
21 0.1
22 0.09
23 0.12
24 0.12
25 0.15
26 0.14
27 0.14
28 0.17
29 0.18
30 0.18
31 0.17
32 0.21
33 0.19
34 0.21
35 0.22
36 0.2
37 0.19
38 0.22
39 0.23
40 0.24
41 0.23
42 0.21
43 0.2
44 0.2
45 0.21
46 0.18
47 0.17
48 0.12
49 0.11
50 0.11
51 0.1
52 0.08
53 0.06
54 0.06
55 0.07
56 0.07
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.06
64 0.07
65 0.07
66 0.11
67 0.12
68 0.12
69 0.12
70 0.13
71 0.13
72 0.12
73 0.14
74 0.16
75 0.22
76 0.24
77 0.29
78 0.32
79 0.32
80 0.35
81 0.39
82 0.35
83 0.34
84 0.34
85 0.3
86 0.33
87 0.4
88 0.39
89 0.41
90 0.42
91 0.38
92 0.39
93 0.43
94 0.46
95 0.5
96 0.55
97 0.58
98 0.59
99 0.66
100 0.74
101 0.8
102 0.81
103 0.82
104 0.82
105 0.83
106 0.91
107 0.93
108 0.93
109 0.92
110 0.94
111 0.94
112 0.95
113 0.95