Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178ZP57

Protein Details
Accession A0A178ZP57    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
92-113TKNQSVPTVSDKKRKKRNKRKVBasic
NLS Segment(s)
PositionSequence
103-113KKRKKRNKRKV
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, cyto 6, cyto_mito 4.833, mito 2.5
Family & Domain DBs
Amino Acid Sequences MTDNEITFSVSFAPKSSCYNEFVNMIVRDSRWPINVSFVGVNAVVGRLVSKNWAEVDFPNMIETIVTHGYTVTITDPNTYTITKTVLGPVMTKNQSVPTVSDKKRKKRNKRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.25
4 0.24
5 0.26
6 0.28
7 0.29
8 0.27
9 0.26
10 0.28
11 0.24
12 0.23
13 0.21
14 0.19
15 0.19
16 0.21
17 0.22
18 0.18
19 0.19
20 0.18
21 0.22
22 0.22
23 0.22
24 0.18
25 0.16
26 0.15
27 0.13
28 0.13
29 0.07
30 0.07
31 0.05
32 0.04
33 0.05
34 0.04
35 0.04
36 0.06
37 0.07
38 0.08
39 0.09
40 0.09
41 0.1
42 0.1
43 0.13
44 0.11
45 0.11
46 0.1
47 0.1
48 0.09
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.06
60 0.07
61 0.07
62 0.09
63 0.1
64 0.12
65 0.13
66 0.13
67 0.13
68 0.13
69 0.14
70 0.14
71 0.14
72 0.14
73 0.15
74 0.16
75 0.16
76 0.18
77 0.24
78 0.25
79 0.25
80 0.23
81 0.24
82 0.25
83 0.25
84 0.25
85 0.26
86 0.35
87 0.4
88 0.49
89 0.56
90 0.64
91 0.73
92 0.82
93 0.85