Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ZYC8

Protein Details
Accession A0A178ZYC8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSRSLLRPSKARRKLVKRKYSKISHAEVHydrophilic
NLS Segment(s)
PositionSequence
7-19RPSKARRKLVKRK
Subcellular Location(s) nucl 13, mito_nucl 11.999, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
Amino Acid Sequences MSRSLLRPSKARRKLVKRKYSKISHAEVEPACPAHDTHQTARPDGHVQEWSRPGSPSLSSAPDAKLLPKVEIDSLQTRLKESVKDWIVEVKSRVRYEIAMYRLNKVLGPEFDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.91
4 0.9
5 0.9
6 0.9
7 0.88
8 0.86
9 0.82
10 0.76
11 0.69
12 0.6
13 0.58
14 0.48
15 0.41
16 0.33
17 0.26
18 0.21
19 0.17
20 0.17
21 0.13
22 0.2
23 0.21
24 0.23
25 0.3
26 0.31
27 0.31
28 0.31
29 0.3
30 0.26
31 0.23
32 0.22
33 0.2
34 0.2
35 0.23
36 0.26
37 0.25
38 0.23
39 0.23
40 0.21
41 0.17
42 0.17
43 0.15
44 0.13
45 0.14
46 0.14
47 0.15
48 0.15
49 0.15
50 0.15
51 0.14
52 0.16
53 0.15
54 0.15
55 0.14
56 0.15
57 0.13
58 0.14
59 0.17
60 0.15
61 0.18
62 0.21
63 0.2
64 0.2
65 0.22
66 0.23
67 0.22
68 0.2
69 0.25
70 0.25
71 0.25
72 0.25
73 0.29
74 0.29
75 0.3
76 0.32
77 0.3
78 0.34
79 0.34
80 0.35
81 0.3
82 0.29
83 0.31
84 0.36
85 0.34
86 0.34
87 0.35
88 0.37
89 0.38
90 0.38
91 0.34
92 0.29
93 0.3