Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DPU5

Protein Details
Accession J9DPU5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
5-25GKNAKENKRVCRRRMTRGVQVHydrophilic
NLS Segment(s)
PositionSequence
71-78GKPDIRKK
88-89KK
Subcellular Location(s) mito 12cyto 12cyto_mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00238  Ribosomal_L14  
Amino Acid Sequences MAAGGKNAKENKRVCRRRMTRGVQVGTVMNCADNTGAKVVKIIAAKGYGGRLNRLPSASPGDIVICTVKKGKPDIRKKVVPVVVIRQKKVWRRKEGLHIGFEDNAGIVILPNGDIKGTQIAGPVPREVSEMWPKISSQASAII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.77
4 0.79
5 0.84
6 0.81
7 0.79
8 0.79
9 0.75
10 0.65
11 0.59
12 0.51
13 0.41
14 0.34
15 0.24
16 0.15
17 0.12
18 0.11
19 0.1
20 0.08
21 0.08
22 0.1
23 0.1
24 0.09
25 0.1
26 0.1
27 0.13
28 0.13
29 0.12
30 0.11
31 0.11
32 0.12
33 0.12
34 0.14
35 0.13
36 0.13
37 0.15
38 0.16
39 0.18
40 0.19
41 0.19
42 0.18
43 0.17
44 0.23
45 0.21
46 0.18
47 0.16
48 0.15
49 0.14
50 0.14
51 0.13
52 0.07
53 0.07
54 0.1
55 0.11
56 0.12
57 0.17
58 0.24
59 0.32
60 0.43
61 0.51
62 0.56
63 0.59
64 0.59
65 0.62
66 0.58
67 0.51
68 0.43
69 0.41
70 0.42
71 0.42
72 0.41
73 0.38
74 0.41
75 0.47
76 0.55
77 0.56
78 0.56
79 0.59
80 0.64
81 0.7
82 0.74
83 0.7
84 0.63
85 0.56
86 0.49
87 0.44
88 0.38
89 0.27
90 0.16
91 0.12
92 0.08
93 0.06
94 0.04
95 0.03
96 0.03
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.08
104 0.09
105 0.09
106 0.1
107 0.12
108 0.16
109 0.18
110 0.18
111 0.16
112 0.16
113 0.18
114 0.17
115 0.22
116 0.28
117 0.29
118 0.31
119 0.31
120 0.31
121 0.32
122 0.34
123 0.28