Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9D7E0

Protein Details
Accession J9D7E0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAKKKNHTNHNQNKKHHRNGIKRVKFSKKPBasic
NLS Segment(s)
PositionSequence
13-29NKKHHRNGIKRVKFSKK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKKKNHTNHNQNKKHHRNGIKRVKFSKKPDFTGVNPKIIKNNYYAVLHQKTGGRTNFDSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.87
4 0.86
5 0.85
6 0.87
7 0.88
8 0.85
9 0.83
10 0.82
11 0.82
12 0.8
13 0.78
14 0.78
15 0.72
16 0.67
17 0.65
18 0.61
19 0.54
20 0.57
21 0.51
22 0.47
23 0.43
24 0.39
25 0.4
26 0.37
27 0.36
28 0.27
29 0.28
30 0.24
31 0.25
32 0.26
33 0.29
34 0.31
35 0.3
36 0.3
37 0.31
38 0.31
39 0.37
40 0.38
41 0.36
42 0.35