Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179GZK4

Protein Details
Accession A0A179GZK4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-67PRSKQFTPYSHPRRRVERRGACQRASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
KEGG plj:VFPFJ_09127  -  
Amino Acid Sequences MPEHHHHPRPSTSHPCRANPAHARLRTTKMGWTRCYWIAVMPRSKQFTPYSHPRRRVERRGACQRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.66
4 0.63
5 0.63
6 0.6
7 0.6
8 0.6
9 0.56
10 0.57
11 0.53
12 0.54
13 0.48
14 0.42
15 0.39
16 0.38
17 0.4
18 0.38
19 0.37
20 0.36
21 0.33
22 0.33
23 0.28
24 0.24
25 0.25
26 0.27
27 0.3
28 0.29
29 0.33
30 0.37
31 0.37
32 0.38
33 0.36
34 0.35
35 0.37
36 0.46
37 0.52
38 0.56
39 0.65
40 0.67
41 0.74
42 0.8
43 0.83
44 0.83
45 0.83
46 0.84
47 0.87