Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DPJ4

Protein Details
Accession J9DPJ4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKRNGFCRNTRKKFKKDLRKKGVPNITSHydrophilic
NLS Segment(s)
PositionSequence
11-21RKKFKKDLRKK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036948  Ribosomal_L21_sf  
IPR001147  Ribosomal_L21e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01157  Ribosomal_L21e  
Amino Acid Sequences MKRNGFCRNTRKKFKKDLRKKGVPNITSLLQVYKNNDYVDIKINSAYNKSMPHKIYHGRTGKVYKVDERTIGVKVKRVSGNREYEDKIDVRKEHLRLSKCRDDFLKRSRAYFEEKKKCESEGLPLPDPKRKQVGGRKAVTISLVNNNPIKVGFEKHFDIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.93
5 0.92
6 0.93
7 0.9
8 0.89
9 0.88
10 0.78
11 0.71
12 0.64
13 0.54
14 0.45
15 0.39
16 0.31
17 0.25
18 0.26
19 0.26
20 0.26
21 0.27
22 0.26
23 0.28
24 0.26
25 0.25
26 0.29
27 0.26
28 0.22
29 0.21
30 0.22
31 0.21
32 0.21
33 0.21
34 0.16
35 0.21
36 0.24
37 0.29
38 0.29
39 0.3
40 0.34
41 0.4
42 0.42
43 0.45
44 0.46
45 0.41
46 0.44
47 0.45
48 0.43
49 0.42
50 0.39
51 0.35
52 0.35
53 0.34
54 0.31
55 0.29
56 0.27
57 0.24
58 0.27
59 0.22
60 0.22
61 0.22
62 0.26
63 0.29
64 0.29
65 0.32
66 0.34
67 0.39
68 0.37
69 0.4
70 0.36
71 0.32
72 0.33
73 0.28
74 0.24
75 0.21
76 0.19
77 0.21
78 0.25
79 0.25
80 0.29
81 0.35
82 0.38
83 0.41
84 0.48
85 0.53
86 0.48
87 0.49
88 0.47
89 0.48
90 0.5
91 0.52
92 0.54
93 0.46
94 0.47
95 0.47
96 0.46
97 0.47
98 0.49
99 0.52
100 0.53
101 0.54
102 0.58
103 0.56
104 0.54
105 0.5
106 0.42
107 0.39
108 0.37
109 0.41
110 0.4
111 0.43
112 0.44
113 0.48
114 0.49
115 0.46
116 0.43
117 0.4
118 0.45
119 0.51
120 0.59
121 0.61
122 0.63
123 0.62
124 0.56
125 0.54
126 0.47
127 0.39
128 0.31
129 0.3
130 0.29
131 0.29
132 0.3
133 0.29
134 0.28
135 0.26
136 0.26
137 0.21
138 0.24
139 0.22
140 0.25