Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HQC0

Protein Details
Accession A0A179HQC0   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-91AVADCFPSGRRRPPRRRRHCSLTGPRPRBasic
NLS Segment(s)
PositionSequence
72-82GRRRPPRRRRH
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
KEGG plj:VFPFJ_01807  -  
Amino Acid Sequences MGGDRESEAAGATGTGGNCCPVSRQPRYPHVCACPLRHQRYHGWQAASSIQLRTSVLLKGPQAAVADCFPSGRRRPPRRRRHCSLTGPRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.11
8 0.16
9 0.24
10 0.3
11 0.39
12 0.44
13 0.54
14 0.61
15 0.62
16 0.61
17 0.57
18 0.59
19 0.54
20 0.53
21 0.53
22 0.56
23 0.58
24 0.55
25 0.54
26 0.52
27 0.56
28 0.58
29 0.52
30 0.44
31 0.38
32 0.37
33 0.34
34 0.3
35 0.23
36 0.16
37 0.12
38 0.11
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.12
45 0.11
46 0.13
47 0.13
48 0.14
49 0.13
50 0.13
51 0.13
52 0.11
53 0.12
54 0.1
55 0.11
56 0.11
57 0.17
58 0.21
59 0.3
60 0.4
61 0.5
62 0.62
63 0.72
64 0.82
65 0.87
66 0.92
67 0.92
68 0.9
69 0.89
70 0.89
71 0.9