Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179GP18

Protein Details
Accession A0A179GP18   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-127GMVALKPRDRSKKKAKARKKKATSBasic
NLS Segment(s)
PositionSequence
109-126KPRDRSKKKAKARKKKAT
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG plj:VFPFJ_02287  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MASHLSQDEFFVGLEKLFNHRKGSDHGAVYLTQKRLSHDQDMPSPTRENPCPDLSPSQPMPVIIRASNGKSRRAEGDKVKLSTIVKPHELDGFYSRYAEVCKAGMVALKPRDRSKKKAKARKKKATS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.16
4 0.22
5 0.25
6 0.27
7 0.28
8 0.31
9 0.35
10 0.42
11 0.42
12 0.37
13 0.35
14 0.32
15 0.32
16 0.33
17 0.33
18 0.27
19 0.24
20 0.24
21 0.26
22 0.31
23 0.34
24 0.36
25 0.35
26 0.37
27 0.4
28 0.43
29 0.41
30 0.37
31 0.35
32 0.31
33 0.31
34 0.3
35 0.29
36 0.29
37 0.3
38 0.29
39 0.3
40 0.32
41 0.28
42 0.31
43 0.27
44 0.24
45 0.21
46 0.2
47 0.19
48 0.17
49 0.17
50 0.12
51 0.13
52 0.13
53 0.15
54 0.21
55 0.22
56 0.25
57 0.24
58 0.26
59 0.3
60 0.33
61 0.36
62 0.36
63 0.43
64 0.43
65 0.43
66 0.42
67 0.39
68 0.36
69 0.34
70 0.33
71 0.28
72 0.25
73 0.25
74 0.26
75 0.27
76 0.26
77 0.24
78 0.22
79 0.21
80 0.18
81 0.18
82 0.17
83 0.15
84 0.16
85 0.15
86 0.13
87 0.11
88 0.11
89 0.1
90 0.11
91 0.12
92 0.13
93 0.19
94 0.25
95 0.3
96 0.34
97 0.42
98 0.53
99 0.57
100 0.65
101 0.69
102 0.72
103 0.78
104 0.85
105 0.88
106 0.89
107 0.94