Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179GE26

Protein Details
Accession A0A179GE26    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
36-55DSKGASTPKKRQETKVSRPFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG plj:VFPFJ_09463  -  
Amino Acid Sequences MIRPLSGRRAEQVGCPASRSTLSFSHMTPPAQLCLDSKGASTPKKRQETKVSRPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.28
4 0.25
5 0.25
6 0.23
7 0.19
8 0.16
9 0.19
10 0.18
11 0.18
12 0.21
13 0.22
14 0.21
15 0.19
16 0.18
17 0.16
18 0.15
19 0.15
20 0.12
21 0.13
22 0.15
23 0.13
24 0.13
25 0.16
26 0.21
27 0.27
28 0.33
29 0.39
30 0.47
31 0.57
32 0.62
33 0.65
34 0.72
35 0.76