Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9DKV6

Protein Details
Accession J9DKV6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
200-238KEKDLEKKMLKTKPEKKPKELMKKIWKISFLKKKRRKIGBasic
NLS Segment(s)
PositionSequence
199-238NKEKDLEKKMLKTKPEKKPKELMKKIWKISFLKKKRRKIG
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000772  Ricin_B_lectin  
CDD cd00161  RICIN  
Amino Acid Sequences MMIVFLFSLTYAIIPGKKYYIETYDMPYKRININSGSVRATTPENLEKFSSKNKIKTQLRFVAEKPFKAGKEVFLIEYENKKYIVSKGPEKFGVVTGDDKSEYRFWSIVESVKAPNTYNIKNDKKCLSFLDANTDDKGHFVQIRKCDNKNGQLFRFVDVEEAEKSTSELDGENKENEKIEKASNDEIEKEKALSELEKNKEKDLEKKMLKTKPEKKPKELMKKIWKISFLKKKRRKIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.17
5 0.19
6 0.22
7 0.23
8 0.26
9 0.26
10 0.31
11 0.38
12 0.38
13 0.38
14 0.37
15 0.36
16 0.37
17 0.39
18 0.36
19 0.3
20 0.35
21 0.38
22 0.39
23 0.37
24 0.32
25 0.29
26 0.27
27 0.26
28 0.21
29 0.22
30 0.26
31 0.25
32 0.26
33 0.28
34 0.28
35 0.28
36 0.34
37 0.39
38 0.38
39 0.45
40 0.5
41 0.58
42 0.65
43 0.69
44 0.71
45 0.7
46 0.67
47 0.63
48 0.57
49 0.58
50 0.53
51 0.46
52 0.42
53 0.39
54 0.35
55 0.36
56 0.35
57 0.26
58 0.28
59 0.29
60 0.24
61 0.2
62 0.22
63 0.2
64 0.24
65 0.23
66 0.19
67 0.18
68 0.18
69 0.18
70 0.2
71 0.25
72 0.25
73 0.32
74 0.34
75 0.37
76 0.38
77 0.37
78 0.34
79 0.28
80 0.25
81 0.17
82 0.16
83 0.14
84 0.14
85 0.14
86 0.13
87 0.13
88 0.13
89 0.13
90 0.13
91 0.12
92 0.11
93 0.13
94 0.15
95 0.15
96 0.15
97 0.15
98 0.14
99 0.16
100 0.16
101 0.14
102 0.17
103 0.18
104 0.19
105 0.22
106 0.3
107 0.36
108 0.37
109 0.4
110 0.41
111 0.38
112 0.39
113 0.36
114 0.33
115 0.29
116 0.27
117 0.32
118 0.3
119 0.29
120 0.28
121 0.26
122 0.2
123 0.17
124 0.17
125 0.1
126 0.11
127 0.14
128 0.18
129 0.24
130 0.33
131 0.38
132 0.39
133 0.45
134 0.48
135 0.53
136 0.56
137 0.56
138 0.49
139 0.5
140 0.5
141 0.44
142 0.4
143 0.31
144 0.24
145 0.18
146 0.19
147 0.12
148 0.13
149 0.11
150 0.1
151 0.1
152 0.09
153 0.08
154 0.07
155 0.07
156 0.09
157 0.12
158 0.15
159 0.17
160 0.18
161 0.19
162 0.2
163 0.2
164 0.21
165 0.19
166 0.2
167 0.2
168 0.23
169 0.26
170 0.28
171 0.29
172 0.29
173 0.3
174 0.29
175 0.27
176 0.23
177 0.2
178 0.17
179 0.17
180 0.16
181 0.2
182 0.26
183 0.32
184 0.39
185 0.41
186 0.43
187 0.48
188 0.49
189 0.51
190 0.51
191 0.55
192 0.53
193 0.6
194 0.66
195 0.66
196 0.71
197 0.73
198 0.75
199 0.76
200 0.81
201 0.81
202 0.79
203 0.83
204 0.86
205 0.86
206 0.86
207 0.86
208 0.86
209 0.87
210 0.87
211 0.83
212 0.79
213 0.74
214 0.75
215 0.76
216 0.75
217 0.77
218 0.79