FuNGI

A0A179GA57

Protein Details

Accession

A0A179GA57

Localization Confidence

Low

Confidence Score

5.6

NoLS Segment(s)

Position	Sequence	Protein Nature
27-53	RKTYRTNRTKDFEYRKKQIRRLYWGLV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 12, cyto_mito 10.333, cyto_nucl 7.833, mito 7.5, nucl 2.5, plas 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR016161 Ald_DH/histidinol_DH IPR016163 Ald_DH_C IPR016162 Ald_DH_N IPR015590 Aldehyde_DH_dom IPR012394 Aldehyde_DH_NAD(P)
Gene Ontology	GO:0016620 F:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor GO:0006081 P:cellular aldehyde metabolic process
KEGG	plj:VFPFJ_08615 -
Pfam	View protein in Pfam PF00171 Aldedh
CDD	cd07135 ALDH_F14-YMR110C

Amino Acid Sequences

MGSIKGGIAPFEATPLEEIQAKYDTLRKTYRTNRTKDFEYRKKQIRRLYWGLVDCAPLIEEALMKDMGKCRYEAHVTELEWCKTECVNVANKLDAWAKDEPVADLPLQYWPMKMRMRSEPLGTILMIGAYNYPYQLNITPVVGAIAAGNTVILKPSEHSPHSAMVLKKLFDEYLDPECYVCVNGALEETKFVMDLKFDKVVFTGGKKTGAIIATKAAQSLTPVLLELGGQNPAFITKHTDLKLAARRLLWQKCLNAGQVCLSHNYVLIDRSLVSKFIGEVNSAYRTFMPQGAKKSPDFSRIVNKMHFDRIKAMVDNTKGKIVMGGATDESEFFIEPTVVLVDSIDDTMMAEESFGPVWSIMPVDSLDEAIDIANQVDPTPLALYTFGSDAENKKVLENVTSGGATANDAFFHCMVNASPIGGVGSSGMGNYHGYYSFKAFSHQRCIANVPAWAEKVLRVRYMPYTWGELERYKKLSAPKPNFDRDGNVVRGLKYWVGLVFGLGGKSASSAALRWGILVAVLSFLGLKRSSLGL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.13
3	0.14
4	0.16
5	0.17
6	0.17
7	0.19
8	0.19
9	0.19
10	0.25
11	0.27
12	0.29
13	0.35
14	0.36
15	0.44
16	0.54
17	0.63
18	0.66
19	0.71
20	0.74
21	0.74
22	0.78
23	0.79
24	0.8
25	0.79
26	0.8
27	0.82
28	0.83
29	0.86
30	0.86
31	0.85
32	0.84
33	0.82
34	0.8
35	0.78
36	0.75
37	0.68
38	0.63
39	0.55
40	0.47
41	0.37
42	0.29
43	0.22
44	0.15
45	0.12
46	0.09
47	0.08
48	0.07
49	0.1
50	0.1
51	0.1
52	0.13
53	0.18
54	0.22
55	0.22
56	0.23
57	0.22
58	0.28
59	0.33
60	0.32
61	0.32
62	0.33
63	0.33
64	0.4
65	0.43
66	0.38
67	0.34
68	0.33
69	0.29
70	0.24
71	0.24
72	0.19
73	0.19
74	0.24
75	0.29
76	0.3
77	0.3
78	0.3
79	0.32
80	0.33
81	0.29
82	0.27
83	0.23
84	0.22
85	0.24
86	0.24
87	0.22
88	0.2
89	0.21
90	0.17
91	0.15
92	0.14
93	0.14
94	0.16
95	0.15
96	0.14
97	0.15
98	0.22
99	0.26
100	0.29
101	0.31
102	0.37
103	0.44
104	0.45
105	0.46
106	0.41
107	0.39
108	0.37
109	0.31
110	0.23
111	0.16
112	0.14
113	0.11
114	0.08
115	0.07
116	0.06
117	0.07
118	0.07
119	0.07
120	0.07
121	0.09
122	0.1
123	0.11
124	0.11
125	0.12
126	0.11
127	0.11
128	0.11
129	0.09
130	0.08
131	0.05
132	0.04
133	0.04
134	0.03
135	0.03
136	0.03
137	0.03
138	0.04
139	0.04
140	0.05
141	0.06
142	0.11
143	0.17
144	0.18
145	0.21
146	0.22
147	0.23
148	0.26
149	0.3
150	0.26
151	0.27
152	0.29
153	0.26
154	0.25
155	0.24
156	0.22
157	0.17
158	0.18
159	0.16
160	0.18
161	0.19
162	0.18
163	0.17
164	0.17
165	0.17
166	0.15
167	0.11
168	0.06
169	0.05
170	0.05
171	0.06
172	0.07
173	0.07
174	0.07
175	0.07
176	0.07
177	0.07
178	0.07
179	0.06
180	0.07
181	0.09
182	0.11
183	0.14
184	0.14
185	0.14
186	0.14
187	0.16
188	0.16
189	0.16
190	0.18
191	0.16
192	0.17
193	0.17
194	0.17
195	0.18
196	0.18
197	0.16
198	0.12
199	0.12
200	0.13
201	0.13
202	0.13
203	0.1
204	0.09
205	0.09
206	0.1
207	0.08
208	0.06
209	0.06
210	0.06
211	0.06
212	0.06
213	0.06
214	0.05
215	0.06
216	0.06
217	0.06
218	0.06
219	0.07
220	0.07
221	0.07
222	0.12
223	0.13
224	0.18
225	0.19
226	0.2
227	0.2
228	0.26
229	0.33
230	0.29
231	0.29
232	0.25
233	0.29
234	0.35
235	0.38
236	0.37
237	0.33
238	0.32
239	0.33
240	0.35
241	0.33
242	0.25
243	0.23
244	0.19
245	0.18
246	0.17
247	0.15
248	0.14
249	0.11
250	0.11
251	0.12
252	0.1
253	0.09
254	0.08
255	0.07
256	0.07
257	0.09
258	0.08
259	0.08
260	0.08
261	0.07
262	0.08
263	0.1
264	0.1
265	0.08
266	0.09
267	0.1
268	0.13
269	0.13
270	0.13
271	0.1
272	0.11
273	0.12
274	0.15
275	0.17
276	0.18
277	0.24
278	0.27
279	0.3
280	0.29
281	0.33
282	0.31
283	0.33
284	0.32
285	0.29
286	0.34
287	0.36
288	0.39
289	0.36
290	0.37
291	0.33
292	0.39
293	0.38
294	0.3
295	0.29
296	0.29
297	0.29
298	0.27
299	0.26
300	0.23
301	0.25
302	0.28
303	0.25
304	0.23
305	0.21
306	0.2
307	0.19
308	0.15
309	0.13
310	0.09
311	0.09
312	0.08
313	0.08
314	0.09
315	0.08
316	0.08
317	0.06
318	0.06
319	0.05
320	0.05
321	0.04
322	0.04
323	0.05
324	0.05
325	0.04
326	0.04
327	0.04
328	0.04
329	0.05
330	0.05
331	0.04
332	0.04
333	0.04
334	0.04
335	0.04
336	0.04
337	0.04
338	0.04
339	0.05
340	0.05
341	0.05
342	0.05
343	0.05
344	0.05
345	0.05
346	0.06
347	0.05
348	0.05
349	0.06
350	0.06
351	0.06
352	0.06
353	0.06
354	0.06
355	0.06
356	0.05
357	0.05
358	0.04
359	0.04
360	0.05
361	0.05
362	0.05
363	0.06
364	0.06
365	0.06
366	0.07
367	0.06
368	0.06
369	0.06
370	0.07
371	0.07
372	0.08
373	0.08
374	0.08
375	0.1
376	0.12
377	0.16
378	0.19
379	0.18
380	0.18
381	0.2
382	0.2
383	0.2
384	0.19
385	0.15
386	0.14
387	0.14
388	0.13
389	0.11
390	0.1
391	0.09
392	0.09
393	0.08
394	0.07
395	0.07
396	0.09
397	0.08
398	0.09
399	0.08
400	0.08
401	0.08
402	0.11
403	0.1
404	0.09
405	0.09
406	0.08
407	0.09
408	0.08
409	0.07
410	0.05
411	0.05
412	0.05
413	0.05
414	0.05
415	0.05
416	0.06
417	0.07
418	0.08
419	0.09
420	0.1
421	0.12
422	0.15
423	0.17
424	0.16
425	0.21
426	0.27
427	0.3
428	0.38
429	0.44
430	0.43
431	0.43
432	0.46
433	0.46
434	0.41
435	0.39
436	0.33
437	0.3
438	0.28
439	0.27
440	0.23
441	0.23
442	0.28
443	0.28
444	0.28
445	0.25
446	0.28
447	0.32
448	0.34
449	0.33
450	0.28
451	0.3
452	0.29
453	0.32
454	0.32
455	0.33
456	0.36
457	0.39
458	0.4
459	0.36
460	0.38
461	0.44
462	0.49
463	0.54
464	0.58
465	0.62
466	0.67
467	0.74
468	0.74
469	0.67
470	0.64
471	0.59
472	0.58
473	0.51
474	0.48
475	0.43
476	0.39
477	0.39
478	0.36
479	0.3
480	0.23
481	0.22
482	0.16
483	0.16
484	0.15
485	0.13
486	0.13
487	0.13
488	0.12
489	0.11
490	0.1
491	0.08
492	0.09
493	0.09
494	0.08
495	0.08
496	0.08
497	0.12
498	0.15
499	0.15
500	0.15
501	0.15
502	0.13
503	0.13
504	0.13
505	0.1
506	0.07
507	0.07
508	0.06
509	0.07
510	0.07
511	0.1
512	0.1
513	0.1

A0A179GA57

3D AlphaFold-predicted Structure Viewer