Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DIA9

Protein Details
Accession J9DIA9   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-67LAEYKNQKKLKKKEKNSEKEHEHNBasic
91-135ISRGMRRKLKVNAKKRKEVTARTSIIKRNQGRKESKKPLHVSTKKHydrophilic
NLS Segment(s)
PositionSequence
51-58KKLKKKEK
89-146KRISRGMRRKLKVNAKKRKEVTARTSIIKRNQGRKESKKPLHVSTKKFFKVGKSHKKE
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MVDAKKKCGSEQAKSNEGKKIPSETSLNKSFDEIPIKVVSKEELAEYKNQKKLKKKEKNSEKEHEHNQKDVIVHNEAVLCEIDNQVANKRISRGMRRKLKVNAKKRKEVTARTSIIKRNQGRKESKKPLHVSTKKFFKVGKSHKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.6
4 0.55
5 0.51
6 0.44
7 0.43
8 0.37
9 0.37
10 0.4
11 0.38
12 0.43
13 0.46
14 0.45
15 0.39
16 0.39
17 0.36
18 0.34
19 0.34
20 0.28
21 0.24
22 0.25
23 0.26
24 0.24
25 0.24
26 0.2
27 0.16
28 0.16
29 0.15
30 0.14
31 0.14
32 0.2
33 0.27
34 0.32
35 0.37
36 0.41
37 0.46
38 0.53
39 0.62
40 0.67
41 0.71
42 0.75
43 0.8
44 0.86
45 0.9
46 0.89
47 0.87
48 0.83
49 0.79
50 0.78
51 0.76
52 0.67
53 0.58
54 0.51
55 0.44
56 0.37
57 0.32
58 0.26
59 0.18
60 0.16
61 0.14
62 0.14
63 0.12
64 0.12
65 0.1
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.09
73 0.14
74 0.15
75 0.15
76 0.17
77 0.21
78 0.26
79 0.36
80 0.43
81 0.48
82 0.57
83 0.59
84 0.65
85 0.7
86 0.75
87 0.75
88 0.77
89 0.78
90 0.75
91 0.82
92 0.78
93 0.78
94 0.76
95 0.74
96 0.71
97 0.7
98 0.66
99 0.61
100 0.64
101 0.6
102 0.6
103 0.61
104 0.61
105 0.61
106 0.66
107 0.7
108 0.75
109 0.78
110 0.82
111 0.84
112 0.84
113 0.84
114 0.81
115 0.81
116 0.81
117 0.8
118 0.77
119 0.76
120 0.78
121 0.72
122 0.7
123 0.63
124 0.61
125 0.63
126 0.66