Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HE97

Protein Details
Accession A0A179HE97    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-129ASSAPAQSKPRRRRRNEDAKLDIDHydrophilic
NLS Segment(s)
PositionSequence
114-120KPRRRRR
141-150PPTKAKRGRK
274-320VKPPRRWRREGVARDPAYHERRGQAAERERRWEEEEDRRYRERRGGR
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG plj:VFPFJ_07171  -  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MSCACRTAPWRAFVQGLAQVHRLEAAPILRVTRAAAGLAPVAPARLALRRALPAAPLRGDRGFHASSGLRQDAAGAAAAKTHEPPNTTRETEEGLSAEPPSSEQEASSAPAQSKPRRRRRNEDAKLDIDESAARPADGAAPPTKAKRGRKPQPDSSSSPTRNNTHDDDPSAANKPQREAWQTQKAALKEKFPSGWKPRKRLSPDALAGIRALNAQFPDVYTTQALADKFEVSAEAIRRILKSKWQPSAAEEEERQQRWFRRGVQVWEHKAALGVKPPRRWRREGVARDPAYHERRGQAAERERRWEEEEDRRYRERRGGRSGGGGGQQSQQQRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.31
4 0.3
5 0.29
6 0.26
7 0.25
8 0.25
9 0.21
10 0.16
11 0.16
12 0.14
13 0.15
14 0.16
15 0.17
16 0.16
17 0.16
18 0.17
19 0.16
20 0.15
21 0.13
22 0.12
23 0.12
24 0.12
25 0.12
26 0.12
27 0.09
28 0.09
29 0.08
30 0.09
31 0.09
32 0.13
33 0.14
34 0.16
35 0.19
36 0.21
37 0.23
38 0.23
39 0.26
40 0.26
41 0.29
42 0.3
43 0.28
44 0.29
45 0.29
46 0.29
47 0.27
48 0.29
49 0.25
50 0.22
51 0.24
52 0.21
53 0.22
54 0.27
55 0.26
56 0.19
57 0.18
58 0.19
59 0.16
60 0.15
61 0.13
62 0.09
63 0.08
64 0.08
65 0.09
66 0.09
67 0.11
68 0.13
69 0.14
70 0.16
71 0.18
72 0.22
73 0.28
74 0.28
75 0.27
76 0.26
77 0.28
78 0.26
79 0.25
80 0.2
81 0.15
82 0.14
83 0.14
84 0.12
85 0.09
86 0.09
87 0.1
88 0.11
89 0.1
90 0.09
91 0.1
92 0.11
93 0.13
94 0.14
95 0.13
96 0.12
97 0.17
98 0.23
99 0.3
100 0.4
101 0.48
102 0.58
103 0.67
104 0.75
105 0.8
106 0.84
107 0.88
108 0.87
109 0.86
110 0.81
111 0.73
112 0.67
113 0.58
114 0.47
115 0.36
116 0.27
117 0.18
118 0.14
119 0.11
120 0.08
121 0.07
122 0.08
123 0.1
124 0.1
125 0.11
126 0.1
127 0.13
128 0.14
129 0.15
130 0.21
131 0.25
132 0.33
133 0.4
134 0.5
135 0.58
136 0.67
137 0.74
138 0.78
139 0.79
140 0.77
141 0.72
142 0.68
143 0.68
144 0.6
145 0.57
146 0.51
147 0.46
148 0.43
149 0.42
150 0.39
151 0.33
152 0.31
153 0.27
154 0.25
155 0.23
156 0.23
157 0.22
158 0.2
159 0.19
160 0.18
161 0.18
162 0.19
163 0.23
164 0.25
165 0.27
166 0.33
167 0.4
168 0.4
169 0.43
170 0.43
171 0.4
172 0.44
173 0.41
174 0.37
175 0.3
176 0.31
177 0.3
178 0.29
179 0.36
180 0.38
181 0.47
182 0.5
183 0.55
184 0.59
185 0.65
186 0.69
187 0.69
188 0.65
189 0.64
190 0.58
191 0.57
192 0.51
193 0.42
194 0.35
195 0.27
196 0.22
197 0.13
198 0.11
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.1
205 0.1
206 0.11
207 0.1
208 0.1
209 0.11
210 0.14
211 0.13
212 0.11
213 0.12
214 0.11
215 0.1
216 0.1
217 0.09
218 0.07
219 0.11
220 0.11
221 0.12
222 0.13
223 0.15
224 0.16
225 0.18
226 0.19
227 0.24
228 0.33
229 0.39
230 0.44
231 0.47
232 0.47
233 0.47
234 0.54
235 0.48
236 0.43
237 0.36
238 0.36
239 0.39
240 0.4
241 0.39
242 0.36
243 0.38
244 0.38
245 0.43
246 0.43
247 0.45
248 0.5
249 0.55
250 0.6
251 0.64
252 0.65
253 0.63
254 0.57
255 0.47
256 0.44
257 0.39
258 0.31
259 0.29
260 0.32
261 0.35
262 0.43
263 0.54
264 0.61
265 0.66
266 0.7
267 0.69
268 0.71
269 0.76
270 0.77
271 0.76
272 0.77
273 0.72
274 0.69
275 0.67
276 0.65
277 0.59
278 0.53
279 0.46
280 0.39
281 0.4
282 0.41
283 0.41
284 0.41
285 0.47
286 0.53
287 0.55
288 0.59
289 0.58
290 0.59
291 0.58
292 0.55
293 0.52
294 0.53
295 0.58
296 0.58
297 0.62
298 0.65
299 0.64
300 0.63
301 0.65
302 0.64
303 0.63
304 0.65
305 0.65
306 0.61
307 0.64
308 0.62
309 0.56
310 0.51
311 0.44
312 0.36
313 0.32
314 0.34