Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HC13

Protein Details
Accession A0A179HC13    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29AIERALKVRNCHRRRPKFPSKPVRGSAAHydrophilic
NLS Segment(s)
PositionSequence
15-22RRPKFPSK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
KEGG plj:VFPFJ_01574  -  
Amino Acid Sequences MAIERALKVRNCHRRRPKFPSKPVRGSAAAALPAPSPAALRPMAREVDVVLARGTTPHEFGSRHDSRKRGRMGEKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.87
4 0.88
5 0.87
6 0.92
7 0.92
8 0.91
9 0.88
10 0.81
11 0.76
12 0.66
13 0.56
14 0.48
15 0.38
16 0.29
17 0.21
18 0.18
19 0.12
20 0.11
21 0.09
22 0.07
23 0.06
24 0.05
25 0.07
26 0.08
27 0.08
28 0.09
29 0.12
30 0.13
31 0.13
32 0.12
33 0.1
34 0.14
35 0.14
36 0.13
37 0.11
38 0.1
39 0.1
40 0.1
41 0.12
42 0.09
43 0.1
44 0.11
45 0.14
46 0.14
47 0.17
48 0.26
49 0.31
50 0.37
51 0.41
52 0.47
53 0.51
54 0.6
55 0.65
56 0.65
57 0.66