Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9DG68

Protein Details
Accession J9DG68   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-38TPSFGLKNKRNCTNCKRCGKPSYHQRHKRCSSCAHydrophilic
NLS Segment(s)
PositionSequence
45-62RSPGSLKAVRRRGQGTGR
Subcellular Location(s) mito_nucl 13.833, nucl 13.5, mito 12, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MSRGTPSFGLKNKRNCTNCKRCGKPSYHQRHKRCSSCAYPEKKMRSPGSLKAVRRRGQGTGRMRHMKTFFKLGYANNNKRIAERGHPLLKEMWKVRARKGLINGRFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.78
4 0.79
5 0.81
6 0.81
7 0.81
8 0.8
9 0.82
10 0.79
11 0.78
12 0.78
13 0.8
14 0.81
15 0.83
16 0.83
17 0.85
18 0.87
19 0.83
20 0.78
21 0.73
22 0.69
23 0.69
24 0.7
25 0.66
26 0.64
27 0.65
28 0.66
29 0.64
30 0.64
31 0.56
32 0.54
33 0.51
34 0.49
35 0.51
36 0.5
37 0.49
38 0.51
39 0.56
40 0.53
41 0.52
42 0.48
43 0.44
44 0.43
45 0.48
46 0.48
47 0.46
48 0.51
49 0.55
50 0.53
51 0.54
52 0.52
53 0.48
54 0.42
55 0.43
56 0.35
57 0.31
58 0.33
59 0.29
60 0.37
61 0.42
62 0.46
63 0.46
64 0.51
65 0.48
66 0.47
67 0.49
68 0.42
69 0.38
70 0.38
71 0.38
72 0.41
73 0.4
74 0.41
75 0.43
76 0.43
77 0.44
78 0.41
79 0.42
80 0.42
81 0.46
82 0.5
83 0.53
84 0.53
85 0.52
86 0.59
87 0.6