Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179GYE7

Protein Details
Accession A0A179GYE7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
394-421RAADRVWARAWRRKKKRAAEAKEKGLEEBasic
NLS Segment(s)
PositionSequence
401-416ARAWRRKKKRAAEAKE
Subcellular Location(s) cyto 10.5, cyto_nucl 9, nucl 6.5, mito 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010286  METTL16/RlmF  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0006725  P:cellular aromatic compound metabolic process  
GO:0034641  P:cellular nitrogen compound metabolic process  
GO:0046483  P:heterocycle metabolic process  
GO:0032259  P:methylation  
GO:1901360  P:organic cyclic compound metabolic process  
GO:0044238  P:primary metabolic process  
KEGG plj:VFPFJ_08810  -  
Pfam View protein in Pfam  
PF05971  Methyltransf_10  
Amino Acid Sequences MGTKRKASAGSDPPAPVDKLPFTHKDCDAAPPRDASAQQAATDRRFRELYARAPDFADLARRDPDFAAVTKGRELDFNDPKAVMQLTKTLLKLDFGLRLELPDDRLCPPVPNRHNYILWLKGLLDTSSYSPPGQKLVGLDIGTGASCIYPLLGCTERPWSFIATDTDAESISWARKNVEINDLAARITVSHRDPSSPLLPLDDLGLASLDFCMTNPPFYASEADMLASAALKARPPRTACTGSPAEMVTPGGEVGFVGRLVDESLTLRTRVRWYTAMLGFLSSVADTVARLRAGGVDNFAVTEFVQGNKTRRWAVAWSFAPMRPAQEVARGTKAASVKLGSGTSILPPQTEHDLRVSPLPDDIGVFVQHLRDTVAALELMSWEWDGEAMEGTGRAADRVWARAWRRKKKRAAEAKEKGLEEQGDDMVDPVCVFGFRVRVRVALDHIDVQCRWMEGFDAVAFESFQGFLKTTAEAATAKAKKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.35
4 0.31
5 0.29
6 0.28
7 0.33
8 0.38
9 0.4
10 0.45
11 0.45
12 0.44
13 0.41
14 0.47
15 0.5
16 0.47
17 0.45
18 0.4
19 0.4
20 0.4
21 0.4
22 0.34
23 0.33
24 0.3
25 0.29
26 0.34
27 0.36
28 0.38
29 0.44
30 0.4
31 0.38
32 0.37
33 0.36
34 0.38
35 0.4
36 0.43
37 0.46
38 0.48
39 0.44
40 0.44
41 0.43
42 0.36
43 0.31
44 0.3
45 0.22
46 0.22
47 0.25
48 0.24
49 0.26
50 0.25
51 0.27
52 0.22
53 0.21
54 0.25
55 0.24
56 0.25
57 0.26
58 0.27
59 0.24
60 0.24
61 0.26
62 0.29
63 0.34
64 0.35
65 0.35
66 0.33
67 0.33
68 0.32
69 0.3
70 0.22
71 0.15
72 0.17
73 0.18
74 0.22
75 0.22
76 0.23
77 0.22
78 0.22
79 0.23
80 0.21
81 0.23
82 0.2
83 0.22
84 0.19
85 0.2
86 0.2
87 0.19
88 0.2
89 0.16
90 0.18
91 0.17
92 0.2
93 0.2
94 0.23
95 0.27
96 0.34
97 0.39
98 0.42
99 0.46
100 0.49
101 0.49
102 0.49
103 0.49
104 0.43
105 0.36
106 0.32
107 0.26
108 0.23
109 0.23
110 0.19
111 0.14
112 0.12
113 0.14
114 0.15
115 0.16
116 0.15
117 0.16
118 0.17
119 0.18
120 0.17
121 0.15
122 0.14
123 0.15
124 0.18
125 0.16
126 0.15
127 0.13
128 0.12
129 0.11
130 0.1
131 0.07
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.04
138 0.08
139 0.09
140 0.09
141 0.11
142 0.19
143 0.19
144 0.21
145 0.21
146 0.19
147 0.18
148 0.21
149 0.22
150 0.18
151 0.18
152 0.17
153 0.16
154 0.15
155 0.14
156 0.11
157 0.1
158 0.1
159 0.11
160 0.11
161 0.11
162 0.14
163 0.17
164 0.19
165 0.23
166 0.21
167 0.21
168 0.23
169 0.22
170 0.19
171 0.16
172 0.14
173 0.09
174 0.1
175 0.11
176 0.11
177 0.14
178 0.15
179 0.16
180 0.17
181 0.2
182 0.21
183 0.2
184 0.18
185 0.16
186 0.16
187 0.14
188 0.14
189 0.1
190 0.08
191 0.06
192 0.06
193 0.04
194 0.04
195 0.04
196 0.03
197 0.03
198 0.03
199 0.07
200 0.07
201 0.08
202 0.08
203 0.11
204 0.11
205 0.12
206 0.14
207 0.11
208 0.11
209 0.11
210 0.11
211 0.08
212 0.08
213 0.07
214 0.05
215 0.04
216 0.04
217 0.05
218 0.06
219 0.09
220 0.11
221 0.16
222 0.18
223 0.21
224 0.26
225 0.3
226 0.29
227 0.32
228 0.32
229 0.28
230 0.27
231 0.24
232 0.18
233 0.14
234 0.13
235 0.07
236 0.06
237 0.05
238 0.04
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.04
250 0.04
251 0.07
252 0.08
253 0.09
254 0.09
255 0.11
256 0.14
257 0.15
258 0.17
259 0.17
260 0.18
261 0.24
262 0.24
263 0.24
264 0.21
265 0.2
266 0.16
267 0.15
268 0.13
269 0.06
270 0.05
271 0.04
272 0.04
273 0.03
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.08
280 0.1
281 0.1
282 0.1
283 0.09
284 0.09
285 0.09
286 0.09
287 0.07
288 0.06
289 0.07
290 0.06
291 0.07
292 0.1
293 0.13
294 0.16
295 0.19
296 0.22
297 0.22
298 0.22
299 0.23
300 0.25
301 0.26
302 0.31
303 0.3
304 0.3
305 0.31
306 0.31
307 0.31
308 0.26
309 0.25
310 0.17
311 0.18
312 0.15
313 0.19
314 0.21
315 0.22
316 0.25
317 0.23
318 0.22
319 0.24
320 0.25
321 0.2
322 0.19
323 0.16
324 0.14
325 0.15
326 0.15
327 0.11
328 0.11
329 0.11
330 0.11
331 0.13
332 0.12
333 0.1
334 0.11
335 0.13
336 0.19
337 0.2
338 0.2
339 0.2
340 0.21
341 0.22
342 0.25
343 0.24
344 0.17
345 0.17
346 0.16
347 0.13
348 0.12
349 0.12
350 0.1
351 0.09
352 0.09
353 0.09
354 0.1
355 0.1
356 0.09
357 0.09
358 0.08
359 0.08
360 0.08
361 0.08
362 0.07
363 0.07
364 0.07
365 0.06
366 0.06
367 0.06
368 0.06
369 0.05
370 0.05
371 0.05
372 0.05
373 0.05
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.07
380 0.06
381 0.06
382 0.06
383 0.1
384 0.12
385 0.15
386 0.17
387 0.24
388 0.3
389 0.39
390 0.5
391 0.57
392 0.66
393 0.74
394 0.82
395 0.84
396 0.89
397 0.91
398 0.91
399 0.91
400 0.89
401 0.89
402 0.85
403 0.75
404 0.65
405 0.58
406 0.48
407 0.38
408 0.31
409 0.22
410 0.16
411 0.15
412 0.15
413 0.11
414 0.1
415 0.08
416 0.06
417 0.06
418 0.05
419 0.06
420 0.08
421 0.16
422 0.17
423 0.22
424 0.23
425 0.25
426 0.28
427 0.3
428 0.32
429 0.29
430 0.31
431 0.32
432 0.32
433 0.35
434 0.32
435 0.3
436 0.27
437 0.23
438 0.21
439 0.15
440 0.15
441 0.11
442 0.14
443 0.13
444 0.12
445 0.12
446 0.12
447 0.12
448 0.1
449 0.1
450 0.08
451 0.09
452 0.1
453 0.1
454 0.11
455 0.12
456 0.13
457 0.13
458 0.13
459 0.14
460 0.13
461 0.14
462 0.24
463 0.26