Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A179HBQ2

Protein Details
Accession A0A179HBQ2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MFYSRVQTLLQRRRKQKRVPMEISAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
KEGG plj:VFPFJ_01014  -  
Amino Acid Sequences MFYSRVQTLLQRRRKQKRVPMEISAPFDLKLEPVCLPGVSEDEISILREKAAASRIGVFEYMPSRSRSPSLHKISRPLRTPSPAVMTSLPPHIAVPARPVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.86
4 0.87
5 0.88
6 0.85
7 0.81
8 0.77
9 0.73
10 0.68
11 0.6
12 0.49
13 0.38
14 0.32
15 0.26
16 0.19
17 0.14
18 0.11
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.1
25 0.1
26 0.09
27 0.09
28 0.07
29 0.08
30 0.08
31 0.09
32 0.09
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.09
39 0.09
40 0.09
41 0.11
42 0.11
43 0.11
44 0.11
45 0.1
46 0.09
47 0.1
48 0.12
49 0.12
50 0.14
51 0.15
52 0.17
53 0.19
54 0.21
55 0.28
56 0.36
57 0.43
58 0.48
59 0.49
60 0.57
61 0.62
62 0.66
63 0.63
64 0.6
65 0.57
66 0.54
67 0.55
68 0.49
69 0.48
70 0.41
71 0.39
72 0.34
73 0.31
74 0.28
75 0.29
76 0.26
77 0.2
78 0.2
79 0.2
80 0.2
81 0.18