Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J9D6I2

Protein Details
Accession J9D6I2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-35AIKTYKTKDHEYKKYKKIYLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 5, mito 3, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036640  ABC1_TM_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
Amino Acid Sequences MARTVSLKHRFQEMRAIKTYKTKDHEYKKYKKIYLSIKKHFIIFIFFSSYFWTFTFLFPFLFHYAMLYICLFPNALAFITLEALWFIILYKMLIKRFFGGINFRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.53
4 0.45
5 0.52
6 0.56
7 0.53
8 0.52
9 0.54
10 0.56
11 0.64
12 0.73
13 0.73
14 0.78
15 0.79
16 0.82
17 0.77
18 0.71
19 0.69
20 0.69
21 0.7
22 0.7
23 0.69
24 0.66
25 0.63
26 0.6
27 0.53
28 0.42
29 0.35
30 0.26
31 0.2
32 0.17
33 0.16
34 0.16
35 0.17
36 0.17
37 0.15
38 0.13
39 0.15
40 0.12
41 0.12
42 0.14
43 0.12
44 0.12
45 0.11
46 0.14
47 0.12
48 0.12
49 0.11
50 0.1
51 0.1
52 0.09
53 0.1
54 0.08
55 0.07
56 0.06
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.05
77 0.1
78 0.14
79 0.18
80 0.2
81 0.22
82 0.23
83 0.25
84 0.27
85 0.27