Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HWF7

Protein Details
Accession A0A179HWF7   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-35GKTDNRACHHQRFLRRRRRSTMPGHRRRRHVYLBasic
NLS Segment(s)
PositionSequence
17-31RRRRRSTMPGHRRRR
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
KEGG plj:VFPFJ_00826  -  
Amino Acid Sequences MPGKTDNRACHHQRFLRRRRRSTMPGHRRRRHVYLDARSWRSLPVTLFVSSVLSPYLAPSPSDASQSNHEPDCQGCLIVGMPQNSGCTLRPDTALRPDGRFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.81
4 0.85
5 0.84
6 0.82
7 0.84
8 0.82
9 0.82
10 0.83
11 0.83
12 0.83
13 0.86
14 0.86
15 0.85
16 0.83
17 0.79
18 0.74
19 0.72
20 0.71
21 0.68
22 0.7
23 0.69
24 0.66
25 0.6
26 0.53
27 0.45
28 0.37
29 0.31
30 0.21
31 0.16
32 0.15
33 0.15
34 0.14
35 0.13
36 0.13
37 0.11
38 0.11
39 0.08
40 0.06
41 0.05
42 0.06
43 0.08
44 0.07
45 0.07
46 0.08
47 0.11
48 0.12
49 0.15
50 0.15
51 0.16
52 0.19
53 0.23
54 0.25
55 0.22
56 0.22
57 0.2
58 0.19
59 0.2
60 0.17
61 0.13
62 0.1
63 0.1
64 0.1
65 0.12
66 0.15
67 0.12
68 0.13
69 0.14
70 0.15
71 0.15
72 0.17
73 0.15
74 0.17
75 0.19
76 0.2
77 0.23
78 0.26
79 0.29
80 0.35
81 0.41
82 0.39