Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HXU7

Protein Details
Accession A0A179HXU7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-47ESAIRRKGARRRPGERIRPEHRBasic
NLS Segment(s)
PositionSequence
30-45RRKGARRRPGERIRPE
Subcellular Location(s) nucl 9, cyto 7, mito 6, extr 3
Family & Domain DBs
KEGG plj:VFPFJ_00480  -  
Amino Acid Sequences MPFLTRAERPGGGGLLCFVEGISYGESAIRRKGARRRPGERIRPEHRAALAADCGSSSRRQGHRQALQLRHCAAAGRLGGISGTTRPGGAGTDRWTSSREQDRGTGRLSDGTEEQLRERMVIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.12
3 0.12
4 0.1
5 0.07
6 0.06
7 0.06
8 0.07
9 0.07
10 0.06
11 0.07
12 0.09
13 0.1
14 0.12
15 0.14
16 0.16
17 0.17
18 0.24
19 0.34
20 0.42
21 0.5
22 0.58
23 0.63
24 0.69
25 0.78
26 0.81
27 0.82
28 0.81
29 0.77
30 0.75
31 0.7
32 0.63
33 0.53
34 0.45
35 0.35
36 0.28
37 0.23
38 0.16
39 0.13
40 0.1
41 0.1
42 0.09
43 0.09
44 0.09
45 0.15
46 0.19
47 0.24
48 0.3
49 0.38
50 0.42
51 0.49
52 0.55
53 0.55
54 0.55
55 0.54
56 0.49
57 0.41
58 0.36
59 0.29
60 0.21
61 0.18
62 0.14
63 0.11
64 0.09
65 0.09
66 0.09
67 0.08
68 0.09
69 0.05
70 0.07
71 0.06
72 0.06
73 0.06
74 0.07
75 0.08
76 0.09
77 0.11
78 0.14
79 0.18
80 0.19
81 0.2
82 0.21
83 0.22
84 0.28
85 0.35
86 0.34
87 0.32
88 0.38
89 0.42
90 0.44
91 0.44
92 0.39
93 0.3
94 0.31
95 0.3
96 0.26
97 0.23
98 0.25
99 0.26
100 0.25
101 0.26
102 0.25
103 0.25