Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HKP3

Protein Details
Accession A0A179HKP3   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-79PDGPWRRKVTKIKKDLIHKAKVKKEYAKIKSQEPRQKPQRKPVRQDDSDBasic
170-189EERAKEAQRRREERERKLAEBasic
NLS Segment(s)
PositionSequence
17-72KKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKEYAKIKSQEPRQKPQRKP
146-211RRRTRRPGYYDKQLRKADEKRAEAEERAKEAQRRREERERKLAERQRFKKAMAKTRGRDGKKKLGR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
KEGG plj:VFPFJ_06357  -  
Amino Acid Sequences MAPKRPLEAADSESASKKPKRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKEYAKIKSQEPRQKPQRKPVRQDDSDDAAADSHRDEDAGALKDRKADHATEAADSAAEKMHPTRELMLKDEEKAQAGAGAEPEDGQGPSDGMRRRTRRPGYYDKQLRKADEKRAEAEERAKEAQRRREERERKLAERQRFKKAMAKTRGRDGKKKLGRESTILLDKVKRLVSEQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.34
4 0.36
5 0.4
6 0.47
7 0.53
8 0.61
9 0.68
10 0.71
11 0.78
12 0.77
13 0.76
14 0.71
15 0.66
16 0.56
17 0.48
18 0.42
19 0.38
20 0.38
21 0.39
22 0.41
23 0.41
24 0.5
25 0.6
26 0.67
27 0.7
28 0.74
29 0.75
30 0.76
31 0.82
32 0.84
33 0.82
34 0.8
35 0.77
36 0.76
37 0.76
38 0.76
39 0.73
40 0.71
41 0.71
42 0.72
43 0.7
44 0.71
45 0.66
46 0.67
47 0.69
48 0.71
49 0.72
50 0.68
51 0.73
52 0.74
53 0.81
54 0.79
55 0.81
56 0.82
57 0.82
58 0.84
59 0.84
60 0.83
61 0.76
62 0.75
63 0.7
64 0.64
65 0.55
66 0.46
67 0.35
68 0.25
69 0.22
70 0.17
71 0.11
72 0.07
73 0.06
74 0.05
75 0.05
76 0.06
77 0.1
78 0.12
79 0.14
80 0.14
81 0.14
82 0.18
83 0.18
84 0.2
85 0.18
86 0.16
87 0.16
88 0.19
89 0.19
90 0.16
91 0.17
92 0.13
93 0.11
94 0.1
95 0.09
96 0.05
97 0.04
98 0.04
99 0.05
100 0.07
101 0.07
102 0.08
103 0.1
104 0.14
105 0.15
106 0.17
107 0.21
108 0.21
109 0.21
110 0.23
111 0.21
112 0.18
113 0.17
114 0.14
115 0.11
116 0.1
117 0.1
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.06
129 0.11
130 0.14
131 0.19
132 0.27
133 0.32
134 0.38
135 0.48
136 0.55
137 0.57
138 0.62
139 0.68
140 0.66
141 0.72
142 0.76
143 0.73
144 0.75
145 0.71
146 0.67
147 0.66
148 0.65
149 0.64
150 0.63
151 0.59
152 0.53
153 0.55
154 0.54
155 0.48
156 0.48
157 0.41
158 0.38
159 0.37
160 0.38
161 0.38
162 0.43
163 0.5
164 0.54
165 0.57
166 0.61
167 0.68
168 0.74
169 0.77
170 0.81
171 0.79
172 0.74
173 0.78
174 0.79
175 0.78
176 0.79
177 0.76
178 0.75
179 0.71
180 0.69
181 0.66
182 0.66
183 0.67
184 0.66
185 0.7
186 0.64
187 0.71
188 0.77
189 0.77
190 0.77
191 0.75
192 0.75
193 0.74
194 0.78
195 0.76
196 0.76
197 0.73
198 0.69
199 0.65
200 0.62
201 0.61
202 0.54
203 0.48
204 0.42
205 0.4
206 0.4
207 0.38
208 0.31