Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J9D7T7

Protein Details
Accession J9D7T7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-28SSTRSRTKTISRKVKNVENKTKAHydrophilic
43-68IEKNTTKKRRLGRRSKKRVNENNFLVHydrophilic
NLS Segment(s)
PositionSequence
48-60TKKRRLGRRSKKR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MMPYMSSTRSRTKTISRKVKNVENKTKAKYGQVDTEQLKNTPIEKNTTKKRRLGRRSKKRVNENNFLVSEYDSYDKDALNTKVKTQINSLYDDINKNNDENKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.68
4 0.73
5 0.76
6 0.81
7 0.81
8 0.81
9 0.81
10 0.79
11 0.79
12 0.74
13 0.73
14 0.65
15 0.6
16 0.56
17 0.49
18 0.47
19 0.43
20 0.45
21 0.41
22 0.43
23 0.39
24 0.33
25 0.3
26 0.24
27 0.23
28 0.2
29 0.2
30 0.21
31 0.24
32 0.32
33 0.41
34 0.49
35 0.52
36 0.54
37 0.61
38 0.66
39 0.72
40 0.76
41 0.77
42 0.79
43 0.86
44 0.89
45 0.9
46 0.9
47 0.9
48 0.86
49 0.84
50 0.76
51 0.7
52 0.61
53 0.53
54 0.43
55 0.33
56 0.26
57 0.19
58 0.16
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.18
65 0.2
66 0.26
67 0.26
68 0.26
69 0.34
70 0.37
71 0.37
72 0.35
73 0.39
74 0.34
75 0.38
76 0.37
77 0.33
78 0.34
79 0.36
80 0.34
81 0.32
82 0.31
83 0.28
84 0.34