Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179I172

Protein Details
Accession A0A179I172    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
9-30RHPPASSKFRPPKLKMPRWPILHydrophilic
NLS Segment(s)
PositionSequence
18-20RPP
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
KEGG plj:VFPFJ_01413  -  
Amino Acid Sequences MRLSAGTRRHPPASSKFRPPKLKMPRWPILSFSAANSPSEGAGREVENMRSYMFLHPTLRQCARICVLARRIAVTDRPRAVLPSSARKAQRSSKDSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.67
4 0.72
5 0.79
6 0.79
7 0.79
8 0.79
9 0.83
10 0.81
11 0.8
12 0.79
13 0.76
14 0.71
15 0.64
16 0.56
17 0.49
18 0.4
19 0.33
20 0.3
21 0.24
22 0.23
23 0.2
24 0.16
25 0.13
26 0.13
27 0.12
28 0.08
29 0.08
30 0.08
31 0.1
32 0.1
33 0.11
34 0.11
35 0.11
36 0.1
37 0.09
38 0.1
39 0.1
40 0.11
41 0.12
42 0.13
43 0.17
44 0.2
45 0.25
46 0.25
47 0.28
48 0.27
49 0.28
50 0.28
51 0.3
52 0.29
53 0.29
54 0.32
55 0.33
56 0.32
57 0.3
58 0.3
59 0.27
60 0.32
61 0.31
62 0.34
63 0.31
64 0.33
65 0.32
66 0.33
67 0.32
68 0.32
69 0.33
70 0.36
71 0.39
72 0.44
73 0.47
74 0.49
75 0.54
76 0.56
77 0.61
78 0.56