Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HWJ1

Protein Details
Accession A0A179HWJ1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-94KGNPRRCKKALRGRVRRTGHHBasic
NLS Segment(s)
PositionSequence
78-89RRCKKALRGRVR
Subcellular Location(s) mito 12, cyto 5, extr 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008427  Extracellular_membr_CFEM_dom  
Gene Ontology GO:0016020  C:membrane  
KEGG plj:VFPFJ_00029  -  
Pfam View protein in Pfam  
PF05730  CFEM  
Amino Acid Sequences MKSTYFIAAFVALAQAKSIDDIPACARDCLRNSVKKVTPQCGESDFHCICPKFDAVRGDAAGCVLGACGAETGKGNPRRCKKALRGRVRRTGHHLSQHERVRLMSCRTNSIRRDCGRRWTPLARAFVRYACNQRKAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.1
5 0.1
6 0.09
7 0.08
8 0.1
9 0.13
10 0.18
11 0.19
12 0.18
13 0.19
14 0.23
15 0.25
16 0.31
17 0.37
18 0.39
19 0.41
20 0.49
21 0.52
22 0.56
23 0.59
24 0.57
25 0.53
26 0.47
27 0.46
28 0.4
29 0.37
30 0.3
31 0.32
32 0.26
33 0.25
34 0.28
35 0.26
36 0.23
37 0.23
38 0.25
39 0.18
40 0.22
41 0.21
42 0.18
43 0.2
44 0.2
45 0.18
46 0.16
47 0.14
48 0.1
49 0.07
50 0.06
51 0.03
52 0.03
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.05
60 0.13
61 0.2
62 0.25
63 0.33
64 0.4
65 0.47
66 0.5
67 0.58
68 0.6
69 0.64
70 0.7
71 0.74
72 0.78
73 0.78
74 0.85
75 0.81
76 0.74
77 0.71
78 0.69
79 0.63
80 0.61
81 0.58
82 0.53
83 0.58
84 0.6
85 0.54
86 0.47
87 0.42
88 0.37
89 0.38
90 0.38
91 0.36
92 0.31
93 0.37
94 0.41
95 0.48
96 0.5
97 0.53
98 0.57
99 0.56
100 0.63
101 0.59
102 0.65
103 0.63
104 0.64
105 0.63
106 0.6
107 0.63
108 0.61
109 0.66
110 0.58
111 0.57
112 0.53
113 0.5
114 0.48
115 0.46
116 0.5
117 0.5