Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179H0W9

Protein Details
Accession A0A179H0W9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-82ATPRLLCLHKCRRRQVRRRVPGRARPASHydrophilic
NLS Segment(s)
PositionSequence
68-77RQVRRRVPGR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 9, cyto 4.5
Family & Domain DBs
KEGG plj:VFPFJ_08822  -  
Amino Acid Sequences MGRIARIVDRNPARGNLQSSAGEGPDSQIRACRTCCQPTTIPPGIGPRLTTSRHATPRLLCLHKCRRRQVRRRVPGRARPASFSYGRIDSSRVASVGSGQGNLLWRTYMLKKSEGAERDSAPAGSGWDGGQQDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.35
4 0.34
5 0.29
6 0.28
7 0.26
8 0.23
9 0.19
10 0.14
11 0.14
12 0.14
13 0.14
14 0.12
15 0.16
16 0.18
17 0.21
18 0.23
19 0.28
20 0.31
21 0.37
22 0.39
23 0.4
24 0.4
25 0.42
26 0.49
27 0.46
28 0.4
29 0.34
30 0.37
31 0.34
32 0.31
33 0.26
34 0.2
35 0.21
36 0.22
37 0.24
38 0.25
39 0.3
40 0.35
41 0.36
42 0.36
43 0.33
44 0.38
45 0.41
46 0.39
47 0.33
48 0.37
49 0.46
50 0.52
51 0.58
52 0.61
53 0.65
54 0.72
55 0.81
56 0.84
57 0.84
58 0.86
59 0.86
60 0.88
61 0.86
62 0.84
63 0.83
64 0.8
65 0.7
66 0.63
67 0.59
68 0.53
69 0.45
70 0.38
71 0.32
72 0.25
73 0.25
74 0.22
75 0.21
76 0.17
77 0.19
78 0.17
79 0.14
80 0.13
81 0.11
82 0.12
83 0.14
84 0.13
85 0.11
86 0.1
87 0.11
88 0.14
89 0.14
90 0.13
91 0.1
92 0.1
93 0.14
94 0.18
95 0.23
96 0.22
97 0.25
98 0.26
99 0.29
100 0.36
101 0.35
102 0.35
103 0.33
104 0.32
105 0.32
106 0.32
107 0.29
108 0.23
109 0.2
110 0.17
111 0.14
112 0.13
113 0.1
114 0.13