Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179HNQ5

Protein Details
Accession A0A179HNQ5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-28SPVGRNRQTRGGKRARKDDRBasic
NLS Segment(s)
PositionSequence
16-26QTRGGKRARKD
Subcellular Location(s) mito 13, plas 4, cyto 3, nucl 2, E.R. 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG plj:VFPFJ_05239  -  
Amino Acid Sequences MGTHVPSPSPVGRNRQTRGGKRARKDDRVASSSHRTPPPRPPFPTEPNQTHPPGRSPLFLTRRSRRTVRLMPATGSCIVLAFPVVTAAFAAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.64
4 0.67
5 0.72
6 0.74
7 0.74
8 0.73
9 0.81
10 0.79
11 0.78
12 0.75
13 0.73
14 0.7
15 0.64
16 0.59
17 0.54
18 0.52
19 0.48
20 0.48
21 0.46
22 0.42
23 0.43
24 0.51
25 0.55
26 0.56
27 0.55
28 0.56
29 0.58
30 0.6
31 0.64
32 0.6
33 0.55
34 0.53
35 0.53
36 0.49
37 0.44
38 0.39
39 0.34
40 0.33
41 0.3
42 0.25
43 0.25
44 0.31
45 0.35
46 0.41
47 0.46
48 0.5
49 0.54
50 0.58
51 0.59
52 0.55
53 0.58
54 0.59
55 0.6
56 0.6
57 0.57
58 0.54
59 0.52
60 0.49
61 0.41
62 0.33
63 0.24
64 0.15
65 0.13
66 0.11
67 0.09
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06