Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179GH90

Protein Details
Accession A0A179GH90    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLMCRQGPPKPTKRKRCIWWWSSGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
KEGG plj:VFPFJ_08158  -  
Amino Acid Sequences MLMCRQGPPKPTKRKRCIWWWSSGSLVPADDSANDRVIRALALPILVLRFWLREAQARAHHVQGTAAPWPGWASPLRQRAPEAATSIRYGSGRGLMHLRQQSFEVGLCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.88
5 0.81
6 0.8
7 0.73
8 0.66
9 0.59
10 0.52
11 0.42
12 0.32
13 0.27
14 0.17
15 0.14
16 0.12
17 0.1
18 0.11
19 0.11
20 0.13
21 0.13
22 0.13
23 0.12
24 0.12
25 0.12
26 0.09
27 0.08
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.07
39 0.08
40 0.12
41 0.14
42 0.17
43 0.2
44 0.24
45 0.24
46 0.24
47 0.25
48 0.2
49 0.19
50 0.16
51 0.14
52 0.12
53 0.11
54 0.1
55 0.09
56 0.1
57 0.09
58 0.1
59 0.1
60 0.12
61 0.19
62 0.28
63 0.3
64 0.31
65 0.32
66 0.34
67 0.36
68 0.34
69 0.3
70 0.25
71 0.25
72 0.24
73 0.24
74 0.22
75 0.19
76 0.17
77 0.15
78 0.18
79 0.16
80 0.17
81 0.21
82 0.21
83 0.29
84 0.34
85 0.34
86 0.3
87 0.31
88 0.31
89 0.28